KEGG   Pongo abelii (Sumatran orangutan): 100434502Help
Entry
100434502         CDS       T01416                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04062  Chemokine signaling pathway
pon04070  Phosphatidylinositol signaling system
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04310  Wnt signaling pathway
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04621  NOD-like receptor signaling pathway
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04726  Serotonergic synapse
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04934  Cushing's syndrome
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon05010  Alzheimer's disease
pon05016  Huntington's disease
pon05142  Chagas disease (American trypanosomiasis)
pon05143  African trypanosomiasis
pon05146  Amoebiasis
pon05200  Pathways in cancer
Module
pon_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100434502 (PLCB1)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100434502 (PLCB1)
   04310 Wnt signaling pathway
    100434502 (PLCB1)
   04371 Apelin signaling pathway
    100434502 (PLCB1)
   04020 Calcium signaling pathway
    100434502 (PLCB1)
   04070 Phosphatidylinositol signaling system
    100434502 (PLCB1)
   04072 Phospholipase D signaling pathway
    100434502 (PLCB1)
   04071 Sphingolipid signaling pathway
    100434502 (PLCB1)
   04022 cGMP - PKG signaling pathway
    100434502 (PLCB1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100434502 (PLCB1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100434502 (PLCB1)
   04621 NOD-like receptor signaling pathway
    100434502 (PLCB1)
   04062 Chemokine signaling pathway
    100434502 (PLCB1)
  Endocrine system
   04911 Insulin secretion
    100434502 (PLCB1)
   04922 Glucagon signaling pathway
    100434502 (PLCB1)
   04912 GnRH signaling pathway
    100434502 (PLCB1)
   04915 Estrogen signaling pathway
    100434502 (PLCB1)
   04921 Oxytocin signaling pathway
    100434502 (PLCB1)
   04926 Relaxin signaling pathway
    100434502 (PLCB1)
   04918 Thyroid hormone synthesis
    100434502 (PLCB1)
   04919 Thyroid hormone signaling pathway
    100434502 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100434502 (PLCB1)
   04916 Melanogenesis
    100434502 (PLCB1)
   04924 Renin secretion
    100434502 (PLCB1)
   04925 Aldosterone synthesis and secretion
    100434502 (PLCB1)
   04927 Cortisol synthesis and secretion
    100434502 (PLCB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100434502 (PLCB1)
   04270 Vascular smooth muscle contraction
    100434502 (PLCB1)
  Digestive system
   04970 Salivary secretion
    100434502 (PLCB1)
   04971 Gastric acid secretion
    100434502 (PLCB1)
   04972 Pancreatic secretion
    100434502 (PLCB1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100434502 (PLCB1)
  Nervous system
   04724 Glutamatergic synapse
    100434502 (PLCB1)
   04725 Cholinergic synapse
    100434502 (PLCB1)
   04728 Dopaminergic synapse
    100434502 (PLCB1)
   04726 Serotonergic synapse
    100434502 (PLCB1)
   04720 Long-term potentiation
    100434502 (PLCB1)
   04730 Long-term depression
    100434502 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    100434502 (PLCB1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100434502 (PLCB1)
  Environmental adaptation
   04713 Circadian entrainment
    100434502 (PLCB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100434502 (PLCB1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100434502 (PLCB1)
   05016 Huntington's disease
    100434502 (PLCB1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100434502 (PLCB1)
   04934 Cushing's syndrome
    100434502 (PLCB1)
  Infectious diseases
   05146 Amoebiasis
    100434502 (PLCB1)
   05142 Chagas disease (American trypanosomiasis)
    100434502 (PLCB1)
   05143 African trypanosomiasis
    100434502 (PLCB1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100434502 (PLCB1)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100434502 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100434502 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 100434502
NCBI-ProteinID: XP_024094755
Ensembl: ENSPPYG00000010700
Position
20
AA seq 1216 aa AA seqDB search
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggccggggctcaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactcaactattgttactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaacaaggag
acggagctactggatctcagccttgtcaaagatgccagatgtgggagacacgccaaagct
cccaaggaccctaaattacgtgaacttttggatgtggggaacatcgggcgcctggagcag
cgcatgatcacagtggtgtatgggcctgacctcgtgaacatctcccatttgaatctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgtattcctctcaaaaacatatatcgcttgttttcagca
gaccggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctcaacaacctttgc
cctcgacctgaaattgataacatcttttcagaatttggtgcaaaaagcaaaccatatctt
accgttgatcagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaa
atactttatccacctctaaaacaagagcaagtccaagtattgattgagaagtatgaaccc
aacaatagcctcgccagaaaaggacaaatatcagtggatgggttcatgcgctatctgagt
ggagaagaaaacggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
ccactttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactg
gctggaaactcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagctggactgctggaagggacggactgcagaagaggaacctgtcatcacccatggcttc
accatgacaactgaaatatctttcaaggaagtgatagaagcaattgcggagtgtgcattt
aagacttcaccttttccaattctcctttcatttgagaaccatgtggattccccaaagcag
caagccaagatggcggagtactgccgactgatctttggggatgcccttctcatggagccc
ctggaaaaatatccactggaatctggagttcctcttccaagccctatggatttaatgtat
aaaattttggtgaaaaataagaagaaatcacataagtcatcagaaggaagcggcaaaaag
aagctctcagaacaagcctccaacacctacagtgactcctccagcgtgttcgagccctca
tccccaggagccggagaagctgatacggaaagtgacgacgacgatgatgatgatgactgt
aaaaaatcttcaatggatgaggggaccgctggaagtgaggctatggccacagaagaaatg
tctaacctggtgaactatattcagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgaacaactcacc
aagtctccggtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatccaactatatgcctcagctcttctggaatgcaggttgtcag
atggtggcacttaatttccagacaatggacctggctatgcaaataaatatggggatgtat
gaatacaacgggaagagtggctacagattgaagccagagttcatgaggaggcctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtggcaaacactttgtctgtt
aagattatttcaggtcagtttctttctgataagaaagttgggacttacgtggaagtggat
atgtttggtttgcctgtggatacaaggaggaaggcatttaagaccaaaacatcccaagga
aatgctgtgaatcctgtctgggaagaagaacctattgtgttcaaaaaggtggttcttcct
actctggcctgtttgagaatagcagtttatgaagaaggaggtaaattcattggccaccgt
atcttgccagtgcaagccattcggccagggtatcactatatctgtctaaggaatgaaagg
aaccagcctctgacgctgcctgctgtctttgtctacatagaagtgaaagactatgtgcca
gacacatatgcagatgtcattgaagctttatcaaacccaatccgatatgtgaacctgatg
gaacagagagctaagcaattggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggagaaacaccatcagaggctccaagtgaagcgagaacgactccagca
gaaaacggggtgaatcacaccacaaccctgacacccaaaccaccctcccaggctctccac
agccagccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gtcttaacagaagtggaagcacagaccatcgaagaactaaagcaacagaaatcgtttgtg
aaacttcaaaagaaacactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactaccaagtataatgaaattcagaatgactacttg
agaaggagagcagccttggaaaagtctgccaaaaaggacagtaagaaaaaatcggaaccc
agcagccctgatcatggttcatcaacgattgagcaagacctcgctgccctggatgctgaa
atgacccaaaagttaatagacttgaaggacaaacaacagcagcagctgcttaatcttcgg
caagaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aagttgacggatgtcgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagaaaagaaagaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagtcagatggaagaggagaagacagagatgatccgg
tcatatatccaggaagtggtgcagtatatcaagaggctagaagaagcgcaaagtaaacga
caagaaaaactcgtagagaaacacaaggaaatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgcccctcgag
attttggaattcgtgcaggaagccatgaaaggaaagatcagtgaagacagcaatcacggt
tctgcccctctctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagt
gaggaactgggaggagacatcccaggaaaagaatttgatactcctctgtga

DBGET integrated database retrieval system