KEGG   Pongo abelii (Sumatran orangutan): 100434648Help
Entry
100434648         CDS       T01416                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit PRKX-like
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100434648
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   100434648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 222 aa AA seqDB search
MYAHILTSVSKHIVTSVCMCIRTPISASVPQHLADGVPPALPWFWTWHDERFLYMLMEYV
PGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLT
DFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNP
FGIYQKILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcccatatcctaacatctgtctctaagcacatcgtaacgtctgtgtgtatgtgc
attcgaacacctatctctgcatctgtaccccaacacctagctgacggcgtaccccctgcc
ctgccctggttctggacgtggcatgacgagcgcttcctctacatgctcatggagtacgtg
ccgggtggcgagctcttcagctacctgcgcaaccgggggcgtttctccagcaccacgggg
ctcttctactctgcggagatcatctgtgccatcgagtacctgcactccaaggagatcgtc
tacagggatttgaagccggagaacatcctgctggatagggatggccacatcaaactcacg
gacttcgggttcgccaagaagctggtagacaggacttggaccctctgtggaacacctgag
tacctagcccccgaagtcattcagagcaagggccacggaagggccgtggactggtgggcc
ctcggcatcctgatattcgagatgctctcggggtttccaccgttttttgatgacaacccg
tttggcatttatcagaaaattcttgcaggcaaaatagatttccccagacatttggatttc
catgtaaaagacctcattaagaaactgctcgtggttgacagaacaaggcgattagggaac
atgaag

DBGET integrated database retrieval system