KEGG   Pongo abelii (Sumatran orangutan): 100434727Help
Entry
100434727         CDS       T01416                                 

Gene name
KAT2A
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:pon04330]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:pon04919]
Human Diseases; Cancers; Viral carcinogenesis [PATH:pon05203]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:pon05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 888 aa AA seqDB search
MKTQLGLQESGSQCTEKDLTLLCLTLHGLGARAPALRCGGRPWAEPSQAPTPAPAAQPRP
LQSPAPAPTPTPAPSPASAPTPTPTPAPAPAPAAAPASSTGTGGPGVGSGGAGSGGDPAR
PGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKGQWKPGKCNGWKNPKPPTAPRMDLQ
QPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDXKQV
YFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFEL
SKMFLLCLNYWKPXDTLPSFRQRSQAEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHV
FGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPSKVRFLSMLEEEIYGANSP
IWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEK
RKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLE
ERRGIIEFHVMGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLAL
IKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGDHTLMNHLKEYHIKHTFFYFLT
YADRVRPSGYFKNQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTAASHIIKKQ
KEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGVEKELKD
PDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYNEVIRFPIGEDLPTMTERLRSRYY
VTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGAH
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgcagttggggcttcaggagagtggctcccagtgcacagagaaagacctcacc
ctcctctgcctcaccctccacgggctgggagcgcgggcgcccgctctccgctgcggggga
aggccatgggcggaaccttcccaggccccgaccccggccccggctgcgcagccccggccc
cttcagtccccagcccctgccccaactccgactcctgcacccagcccggcttcagccccg
actccgactcccactccggcaccagcccctgccccagctgcagccccagccagcagcaca
ggaactggggggcccggggtaggaagtgggggggccgggagcgggggggatcctgctcga
cctggcctgagccagcagcagcgcgccagtcagaggaaggcgcaagtccgggggctgccg
cgcgccaagaagcttgagaagctaggggtcttctcggcttgcaagggccaatggaaacct
ggtaaatgtaatggctggaaaaaccccaagccccccactgcaccccgcatggatctgcag
cagccagctgccaacctgagtgagctgtgccgcagttgtgagcaccccttggctgaccac
gtatcccacttggagaatgtgtcagaggatgagataaaccgactgctggggatggtggtg
gatgtggagaatctcttcatgtctgttcacaaggaagaggacacagacnccaagcaggtc
tatttctacctcttcaagctactgcggaaatgcatcctgcagatgacccggcccgtggtg
gaggggtccctgggcagccctccatttgagaaacctaatattgagcagggtgtgctgaac
tttgtgcagtacaagtttagtcacctggctccccgggagcggcagacgatgttcgagctc
tcaaagatgttcttgctctgccttaactactggaagccttgagacaccctgcccagtttt
cggcagaggtctcaggctgaggacgtggctacctacaaggtcaattacaccagatggctc
tgttactgccacgtgccccagagctgtgatagcctcccccgctacgaaaccactcacgtc
tttgggcgaagccttctccggtccattttcactgttacccgccggcagctgctggaaaag
ttccgagtggagaaggacaaattggtgcctgagaagaggaccctcatcctcactcacttc
ccctccaaagtaagattcctgtccatgctggaggaggagatctatggggcaaactctcca
atctgggagtcaggcttcaccatgccaccctcagaggggacacagctggtgccccggcca
gcttcagtcagtgcagcggttgttcccagcacccccatcttcagccccagcatgggtggg
ggcagcaacagctccctgagtctggattctgcaggggccgagcctatgccaggcgagaag
aggaagctcccagagaacctgaccctggaggatgccaagcggctccgtgtgatgggtgac
atccccatggagctggtcaatgaggtcatgctgaccatcactgaccctgctgccatgctg
gggcctgagacgagcctgctttcggccaatgcggcccgggatgagacagcccgcctggag
gagcgccgcggcatcatcgagttccatgtcatgggcaactcgctgacgcccaaggccaac
cggcgggtgttgctgtggctcgtggggctgcagaatgtcttttcccaccagctgccacgc
atgcctaaggagtatatcgcccgcctcgtttttgacccgaagcacaagactctggccttg
atcaaggacgggcgggtcatcggtggcatctgcttccgcatgtttcccacccagggcttc
acggagattgtcttctgtgctgtcacctcgaatgagcaggtcaagggttatggggaccac
accctgatgaaccacctgaaggagtatcacatcaagcacacattcttctacttcctcacc
tacgccgaccgagtacgcccatcgggctacttcaaaaatcagggtttctccaaggacatc
aaggtgcctaagagccgctacctgggctacatcaaggactacgagggagcgacgctgatg
gagtgtgagctgaatccccgcatcccctacacggcagcttcccacatcatcaagaagcag
aaagagatcatcaagaagctgattgagcgcaaacaggcccagatccgcaaggtctacccg
gggctcagctgcttcaaggagggtgtgaggcagatccctgtggagagcgttcccggcatt
cgagagacaggctggaagccattggggaaggagaagggtgtggagaaggagctgaaggac
cctgaccagctctacacaacccttaaaaacctgctggcccaaatcaagtcgcaccccagt
gcctggcccttcatggagcctgtgaagaagtcggaggcccctgactacaacgaggtcatc
cgcttccccattggtgaggaccttccgaccatgactgagcggctgcgaagccgctactac
gtgacccggaagctctttgtggccgacctgcagcgggtcatcgccaactgtcgcgagtac
aaccccccggacagcgagtactgccgctgcgccagcgctctggagaagttcttctacttc
aagctcaaggagggaggggctcattga

DBGET integrated database retrieval system