KEGG   Pongo abelii (Sumatran orangutan): 100434727Help
Entry
100434727         CDS       T01416                                 

Gene name
KAT2A
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100434727 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100434727 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100434727 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    100434727 (KAT2A)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100434727 (KAT2A)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100434727 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 899 aa AA seqDB search
MKTQLGLQESGSQCTEKDLTLLCLTLHGLGARAPALRCGGRPWAEPSQAPTPAPAAQPRP
LQSPAPAPTPTPAPSPASAPTPTPTPAPAPAPAAAPASSTGTGGPGVGSGGAGSGGDPAR
PGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKGQWKPGKCNGWKNPKPXPTAPRMDL
QQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDXKQ
VYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFE
LSKMFLSALNYWKPXDTLPSFRQRSQAEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTH
VFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPRFLSMLEEEIYGANSPIW
ESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRK
LPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEER
RGIIEFHVMGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIK
DGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGDHTLMNHLKEYHIKHKHSSTSSPT
PTEYAHRATSKMPGEPGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTAASHIIK
KQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKD
PDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYNEVIRFPIGEDLPFHPLPSSSTXT
TMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGAH
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgcagttggggcttcaggagagtggctcccagtgcacagagaaagacctcacc
ctcctctgcctcaccctccacgggctgggagcgcgggcgcccgctctccgctgcggggga
aggccatgggcggaaccttcccaggccccgaccccggccccggctgcgcagccccggccc
cttcagtccccagcccctgccccaactccgactcctgcacccagcccggcttcagccccg
actccgactcccactccggcaccagcccctgccccagctgcagccccagccagcagcaca
ggaactggggggcccggggtaggaagtgggggggccgggagcgggggggatcctgctcga
cctggcctgagccagcagcagcgcgccagtcagaggaaggcgcaagtccgggggctgccg
cgcgccaagaagcttgagaagctaggggtcttctcggcttgcaagggccaatggaaacct
ggtaaatgtaatggctggaaaaaccccaagcccnnccccactgcaccccgcatggatctg
cagcagccagctgccaacctgagtgagctgtgccgcagttgtgagcaccccttggctgac
cacgtatcccacttggagaatgtgtcagaggatgagataaaccgactgctggggatggtg
gtggatgtggagaatctcttcatgtctgttcacaaggaagaggacacagacnccaagcag
gtctatttctacctcttcaagctactgcggaaatgcatcctgcagatgacccggcccgtg
gtggaggggtccctgggcagccctccatttgagaaacctaatattgagcagggtgtgctg
aactttgtgcagtacaagtttagtcacctggctccccgggagcggcagacgatgttcgag
ctctcaaagatgttcttgtctgcccttaactactggaagccttgagacaccctgcccagt
tttcggcagaggtctcaggctgaggacgtggctacctacaaggtcaattacaccagatgg
ctctgttactgccacgtgccccagagctgtgatagcctcccccgctacgaaaccactcac
gtctttgggcgaagccttctccggtccattttcactgttacccgccggcagctgctggaa
aagttccgagtggagaaggacaaattggtgcctgagaagaggaccctcatcctcactcac
ttccccagattcctgtccatgctggaggaggagatctatggggcaaactctccaatctgg
gagtcaggcttcaccatgccaccctcagaggggacacagctggtgccccggccagcttca
gtcagtgcagcggttgttcccagcacccccatcttcagccccagcatgggtgggggcagc
aacagctccctgagtctggattctgcaggggccgagcctatgccaggcgagaagaggaag
ctcccagagaacctgaccctggaggatgccaagcggctccgtgtgatgggtgacatcccc
atggagctggtcaatgaggtcatgctgaccatcactgaccctgctgccatgctggggcct
gagacgagcctgctttcggccaatgcggcccgggatgagacagcccgcctggaggagcgc
cgcggcatcatcgagttccatgtcatgggcaactcgctgacgcccaaggccaaccggcgg
gtgttgctgtggctcgtggggctgcagaatgtcttttcccaccagctgccacgcatgcct
aaggagtatatcgcccgcctcgtttttgacccgaagcacaagactctggccttgatcaag
gacgggcgggtcatcggtggcatctgcttccgcatgtttcccacccagggcttcacggag
attgtcttctgtgctgtcacctcgaatgagcaggtcaagggttatggggaccacaccctg
atgaaccacctgaaggagtatcacatcaagcacaaacattcttctacttcctcacctacg
ccgaccgagtacgcccatcgggctacttcaaaaatgccaggtgaacccggtttctccaag
gacatcaaggtgcctaagagccgctacctgggctacatcaaggactacgagggagcgacg
ctgatggagtgtgagctgaatccccgcatcccctacacggcagcttcccacatcatcaag
aagcagaaagagatcatcaagaagctgattgagcgcaaacaggcccagatccgcaaggtc
tacccggggctcagctgcttcaaggagggtgtgaggcagatccctgtggagagcgttccc
ggcattcgagagacaggctggaagccattggggaaggagaaggggaaggagctgaaggac
cctgaccagctctacacaacccttaaaaacctgctggcccaaatcaagtcgcaccccagt
gcctggcccttcatggagcctgtgaagaagtcggaggcccctgactacaacgaggtcatc
cgcttccccattggtgaggaccttccattccatccccttccttcctcttctacctgaacg
accatgactgagcggctgcgaagccgctactacgtgacccggaagctctttgtggccgac
ctgcagcgggtcatcgccaactgtcgcgagtacaaccccccggacagcgagtactgccgc
tgcgccagcgctctggagaagttcttctacttcaagctcaaggagggaggggctcattga

DBGET integrated database retrieval system