KEGG   Pongo abelii (Sumatran orangutan): 100434735Help
Entry
100434735         CDS       T01416                                 

Gene name
GAMT
Definition
guanidinoacetate N-methyltransferase
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100434735 (GAMT)
   00330 Arginine and proline metabolism
    100434735 (GAMT)
Enzymes [BR:pon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     100434735 (GAMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 256 aa AA seqDB search
MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSK
GGRVLEVGFGMAIAASKMQEGPIDEHWIIECNDGVFQRLQDWAPRQIHKVVPLKGLWEDV
APTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTMLSLLKXXXXGTAQKLLPALGNWRFP
FAPGLPGLPCHVPTGAAAAHPDLAICKHSSETQVPALLEAGFQRENINTEVMALVPPADC
RYYAFPQMITPLVTKG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccccagcgcaacccccatcttcgcgcccggcgagaactgcagccccgcgtgg
ggggcggcgcccgcggcctacgacgcggcggacacgcacctgcgcatcctgggcaagccg
gtgatggagcgctgggagaccccctatatgcacgcgctggccgccgccgcctcctccaaa
gggggccgggtcctggaggtgggctttggcatggccatcgcagcgtcaaagatgcaggag
gggcccattgatgagcattggatcatcgagtgcaatgacggcgtcttccagcggctccag
gactgggccccgcggcagatacacaaggtcgtccccttgaaaggtctgtgggaggatgtg
gcacccaccctgcctgacggtcactttgatgggatcctgtacgacacgtacccactctcg
gaggagacctggcacacacaccagttcaacttcatcaagaccatgctttcgctgctgaag
cnnnnnnnnnnggggacagcccagaagctgctgcccgcattggggaactggagattcccg
ttcgcacctgggcttccaggactgccctgccacgtgcccacgggagctgcagccgcccac
ccggaccttgccatctgtaaacactcttcagagacgcaggtgcccgcgctgctggaggct
ggcttccagagggagaacatcaataccgaggtgatggcgctggtcccaccagccgactgc
cgctactacgccttcccacagatgatcacgcccctggtcaccaagggctga

DBGET integrated database retrieval system