KEGG   Pongo abelii (Sumatran orangutan): 100434840Help
Entry
100434840         CDS       T01416                                 

Definition
(RefSeq) chymotrypsinogen B isoform X1
  KO
K01310  chymotrypsin [EC:3.4.21.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100434840
Peptidases [BR:pon01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100434840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF316
Motif
Other DBs
NCBI-GeneID: 100434840
NCBI-ProteinID: XP_024088955
Position
16
AA seq 263 aa AA seqDB search
MAFLWLLSCWALLGTAFGCGVPTIHPVLSGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDKENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQATLPL
LSNAECKKFWGRKITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQQILAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctctggctgctctcctgctgggccctcctgggcactgccttcggctgcgga
gtccccaccatccaccctgtgctcagcggcctgtccaggatcgtgaatggggaggacgcc
atccccggctcctggccctggcaggtgtccctgcaggacaaaaccggcttccacttctgc
ggaggctccctcatcagcgaggactgggtggtcaccgccgcccactgcggggtcaggacc
tccgacgttgtcgtggccggggagtttgaccagggctctgacaaagagaacatccaggtc
ctgaagatcgccaaggtcttcaagaaccccaagttcagcattctgaccgtgaacaatgac
atcaccctgctgaagctggccacacctgcccgcttctcccagacggtgtccgccgtgtgc
ctgcccagtgccgacgacgacttccccgcggggacactgtgtgccaccacaggctggggc
aagaccaagtacaacgccaacaagacccccgataagctgcagcaggcgaccctgcccctc
ctgtccaatgccgaatgcaagaagttctggggcagaaagatcaccgacgtgatgatctgt
gccggggccagtggcgtctcctcctgtatgggcgactccggcggccccctggtctgccag
aaggatggagcctggaccctggtgggcattgtgtcctggggcagcgacacctgctccacc
tccagccccggcgtgtacgcccgtgtcaccaagctcataccctgggtgcagcagatcctg
gctgccaactga

DBGET integrated database retrieval system