KEGG   Pongo abelii (Sumatran orangutan): 100434840Help
Entry
100434840         CDS       T01416                                 

Gene name
CTRB1
Definition
chymotrypsinogen B1
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100434840 (CTRB1)
Peptidases [BR:pon01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100434840 (CTRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 255 aa AA seqDB search
MAFLWLLSCWALLGTAFGCGVPTIHPVLSGLSRIVNGEDAIPRSWPWQVSLQGDSGGPLV
CQKDGAWTLVGIVSWGSNTCSTSSPGVYARVTKLIPWVFKNPKFSILTVNNDITLLKLAT
PARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQATLPLLSNAECKK
FWGRKITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYAR
VTKLIPWVQQILAAN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctctggctgctctcctgctgggccctcctgggcactgccttcggctgcgga
gtccccaccatccaccctgtgctcagcggcctgtccaggatcgtgaatggggaggacgcc
atcccgaggtcctggccctggcaggtgtccctgcagggcgactccggcggccccctggtc
tgccagaaggatggagcctggaccctggtgggcattgtgtcctggggcagcaacacctgc
tccacctccagccccggcgtgtatgcccgtgtcaccaagctcataccctgggtcttcaag
aaccccaagttcagcattctgaccgtgaacaatgacatcaccctgctgaagctggccaca
cctgcccgcttctcccagacggtgtccgccgtgtgcctgcccagtgccgacgacgacttc
cccgcggggacactgtgtgccaccacaggctggggcaagaccaagtacaacgccaacaag
acccccgataagctgcagcaggcgaccctgcccctcctgtccaatgccgaatgcaagaag
ttctggggcagaaagatcaccgacgtgatgatctgtgccggggccagtggcgtctcctcc
tgtatgggcgactccggcggccccctggtctgccagaaggatggagcctggaccctggtg
ggcattgtgtcctggggcagcgacacctgctccacctccagccccggcgtgtacgcccgt
gtcaccaagctcataccctgggtgcagcagatcctggctgccaactga

DBGET integrated database retrieval system