KEGG   Pongo abelii (Sumatran orangutan): 100434899Help
Entry
100434899         CDS       T01416                                 

Definition
cytochrome P450 3A5-like
Orthology
K17690  
cytochrome P450, family 3, subfamily A, polypeptide 5 [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Steroid hormone biosynthesis
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100434899
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100434899
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100434899
   00982 Drug metabolism - cytochrome P450
    100434899
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100434899
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100434899
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP3 family
   100434899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 502 aa AA seqDB search
MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKF
DTECYKKYGKMWGTYDGQLPVLAITDPDMIKTVLVKECYSVFTNRRSLGPVGFMKSAISL
AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS
MDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFSFLDPLFLSIILFPFLTPVFEALNVSL
FPKDTINFLNKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI
IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVV
NETLRLFPVAIRLERTCKKDVEINGVFIPKGAMVVIPTYALHHDPKYWTEPEEFRPERFS
KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG
LLQPEKPIVLKVDSRDGTLSGE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggacctcatcccaaatttggcggtggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatatgggacccgtacacatggactttttaagagactgggaattccaggg
cccacacctctgcctttgttgggaaatgttttgtcctatcgtcagggtctctggaaattt
gacacagaatgttataaaaagtatggaaaaatgtggggaacgtatgatggtcaactccct
gtgctggccatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaatcgaaggtctttaggcccagtgggatttatgaaaagtgccatctcttta
gctgaggatgaagaatggaagagaatacggtcattgctgtctccaaccttcaccagcgga
aaactcaaggagatgttccccatcattgcccagtatggagatgtattggtgagaaacttg
aggcgggaagcagagaaaggcaagcctgtcaccttgaaagacatctttggggcctacagc
atggatgtgatcactggcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggaaagcactaagaagttcctaaaatttagtttcttagatccattattt
ctctcaataatactctttccattccttaccccagtttttgaagcattaaacgtctccctg
tttccaaaagataccataaattttttaaataaatctgtaaacagaatgaagaaaagtcgc
ctcaacgacaaacaaaagcaccgactggatttccttcagctgatgattgactcccagaat
tcgaaagaaactgagtcccacaaagctctgtctgatctggagctcgcggcccagtcaata
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcactttatatgaa
ctggccactcaccctgatgtccagcagaaactgcaaaaggagattgatgcagttttgccc
aataaggcaccacctacctatgatgccgtggtacagatggagtaccttgacatggtggtg
aatgaaacactcagattattcccagttgctattagacttgagaggacctgcaagaaagat
gttgaaatcaatggggtattcattcccaaaggggcaatggtggtgattccaacctatgct
cttcaccatgacccaaagtactggacagagcctgaggagttccgccctgaaaggttcagt
aagaagaaggacagcatagatccttacatatacacaccctttggaactggacccagaaac
tgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtccttcag
aacttctccttcaaaccttgtaaagaaacacagatccccttgaaattagacacgcaagga
cttcttcaaccagaaaaacccattgttctaaaggtggattcaagagatggaaccctaagt
ggagaatga

DBGET integrated database retrieval system