KEGG   Pongo abelii (Sumatran orangutan): 100435148Help
Entry
100435148         CDS       T01416                                 

Gene name
PDK4
Definition
pyruvate dehydrogenase kinase, isozyme 4
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100435148 (PDK4)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100435148 (PDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 411 aa AA seqDB search
MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQE
LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTL
IKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIF
SDSQTGNPSHIGSIDPNCDVVAVVQDAFECSRMLCDQYYLTSPELKLTQVNGKFPDQPIH
IVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPVEVIVVLGKEDLTIKISDRGGGVPL
RIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDA
IIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggcccgcttcgtgctgcgcagcgctggctcgctcaacggcgccggcctggtg
ccccgagaggtggagcatttctcgcgctacagcccgtccccgctgtccatgaagcagcta
ctggactttggttcagaaaatgcatgtgaaagaacttcttttgcatttttgcgacaagaa
ttgcctgtgaggctcgccaacattctgaaggaaattgatatcctcccgacccaattagta
aatacttcttcagtgcaattggttaaaagctggtatatacagagcctgatggatttggtg
gaattccatgagaaaagcccagatgaccagaaagcattatcagactttgtagatacactc
atcaaagttcgaaatagacaccataatgtagtccctacaatggcacaaggaatcatagag
tataaagatgcctgtacagttgacccagtcaccaatcaaaatcttcaatatttcttggat
cgattttacatgaaccgtatttctactcggatgctgatgaaccagcacattcttatattt
agtgactcacagacaggaaacccaagccacattggaagcattgatcctaactgtgatgtg
gtagcagtggtccaagacgcctttgagtgttcaaggatgctctgtgatcagtattattta
acatctccagaattaaagcttacacaagtgaatggaaaatttccagaccaaccaattcac
atcgtgtatgttccttctcacctccatcatatgctctttgaactgtttaagaatgcaatg
cgggcaacagttgaacaccaggaaaatcagccttcccttacaccagttgaggttattgtt
gtcttgggaaaagaagaccttaccattaagatttcagatagaggaggtggtgttcccctg
agaattattgaccgcctctttagttatacatactccactgcaccaacgcctgtgatggat
aattcccggaatgctcctttggctggttttggttatggcttgccaatttctcgtctgtat
gccaagtactttcaaggagatctgaatctctactctttatcaggatatggaacagatgct
atcatctacttaaaggctttgtcttctgagtctatagaaaaacttccagtttttaacaag
tcagccttcaaacattatcagatgagctctgaggctgatgactggtgtatcccaagcagg
gaaccaaagaacctggcaaaagaagtggccatgtga

DBGET integrated database retrieval system