KEGG   Pongo abelii (Sumatran orangutan): 100435205Help
Entry
100435205         CDS       T01416                                 

Gene name
ASPG
Definition
asparaginase homolog (S. cerevisiae)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100435205 (ASPG)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     100435205 (ASPG)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     100435205 (ASPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 573 aa AA seqDB search
MARAVGPERRLLAVYTGGTIGMRSELGVLVPGTGLAAILRTLPMFHDEEHARARGLSEDT
LVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVRVAQTIERHYEQYHGFVVIHGTDTMA
FAASMLSFMLENLQKTVILTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRTTKVDARRFAAFCSPNLLPLATVGADITINRELVRKVDRKAGLVVHSSMEQDVGL
LRLYPGIPAALVRAFLQPPLKGMVMETFGSGNGPTKPDLLQELRVATERGLVIVNCTHCL
QGAVTTDYAAGMAMAGAGVISGFDMTSEAALAKLSYVLGQPGLSLDDRKELLTKDLRGEM
TPPSVEERRPSLQGNTLGRGVSWLLSLNGSQEADALRNALMPSLACAAAHAGDLEALQAL
VELGSDLGLVDFNGQTPLHAAARGGHAEAVTMLLQRGVDVNTRDTDGFSPLLLAVRGRHP
GVIGLLREAGASLSTQELEEAGTELCRLAYRADLEGLQVWWQAGADLGQPGYDGHSALHV
AEAAGNLAVVAFLQSLEGVVGAQASCPEVLPGV
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgcggtggggcccgagcggaggctgctggccgtctacacaggcggcaccatt
ggcatgcggagtgagctcggcgtgctcgtgcccgggacgggcctggctgccatcctgagg
acactgcccatgttccatgacgaggagcatgcccgagcccgcggcctctctgaggacacc
ctggtgctgcccccggccagccgcaaccagaggatcctctacaccgtgctggagtgccag
cccctcttcgactctagtgacatgaccatcgctgagtgggttcgcgttgctcagaccatc
gagaggcactacgagcagtaccatggctttgtggtcatccacggcactgacaccatggcc
tttgctgcctcgatgctgtccttcatgctggagaacctgcagaagaccgtcatcctcact
ggggcccaggtgcccatccatgccctgtggagcgacggccgtgagaacctgctgggggca
ctgctcatggccggccagtatgtgatcccagaggtctgcctcttcttccagaatcagctg
tttcggggcaaccggacgaccaaggtggacgctcggaggttcgcggccttctgctccccg
aacctgctgcctctggccacagtgggtgctgacatcacaatcaacagggagctggtgcgg
aaggtcgacaggaaggctgggctggtggtgcacagcagcatggagcaggacgtgggcctg
ctgcgcctctaccctgggatccctgccgccctggttcgggccttcttgcagccccccctg
aagggtatggtcatggagaccttcggttcggggaacggacccaccaagcccgacctgctg
caggagctgcgggtggccaccgagcgcggcctggtcatcgtcaactgtacccactgcctc
cagggggctgtgaccacagactatgcagctggcatggccatggcgggagccggcgtcatc
tcaggcttcgacatgacatcggaggccgccctggccaagctatcgtatgtgctgggccag
ccagggctgagcctggatgacaggaaggagctgctgaccaaggaccttcgtggggagatg
acgccaccctcggtggaagagcgccggccctcactgcagggcaacacgctgggccgtggg
gtctcctggctcctcagtctgaacggcagccaggaggcagatgccctgcgcaatgccctg
atgcccagcctggcctgtgctgctgcccacgccggtgacctggaggcgctgcaggcgctt
gtggagctgggcagtgacctgggcctggtggactttaacggccaaaccccactgcacgcg
gccgcccggggaggccacgcagaggcagtcaccatgctgctgcagagaggtgtggatgtg
aacacccgggacacagacggcttcagcccgctgctgctggctgtgcggggcaggcatccg
ggtgtcattgggttgctgcgggaagccggggcctccctgtccacccaggagctggaggaa
gcagggacggagctgtgcaggctggcatacagggccgacctcgaaggcctgcaggtgtgg
tggcaggcaggggctgacctggggcagccaggctatgatgggcacagcgccctgcatgtc
gcagaggcagccgggaacctggcagtggtggcctttctacagagcctggagggtgtggtt
ggtgcccaggcctcatgcccagaagtgctgcctggtgtctaa

DBGET integrated database retrieval system