KEGG   Pongo abelii (Sumatran orangutan): 100435315Help
Entry
100435315         CDS       T01416                                 

Definition
phosphoglycerate mutase 1-like
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100435315
   01230 Biosynthesis of amino acids
    100435315
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100435315
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100435315
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100435315
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100435315
Enzymes [BR:pon01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100435315
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100435315
  Exosomal proteins of melanoma cells
   100435315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 129 aa AA seqDB search
MEPDHPFYSNISKDRRHADLTEDQLPSCESLKDTIARTLPFWNEEIVPQIKEGKCVLIAA
HGNSLQGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEEMVRKAMEA
VAAQGKAKK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgaccatcctttctacagcaacatcagtaaggatcgcaggcatgcagacctc
acagaagatcagctaccctcctgtgagagtctgaaggacactattgccagaactctgcct
ttctggaatgaagaaatagttccccagatcaaggaggggaaatgtgtactgattgcagcc
catggcaacagcctccagggcattgtcaagcatctggagggtctctctgaagaggctatc
atggagctgaacctgccgactggtattcccattgtctatgaattggacaagaacttgaag
cctatcaagcccatgcagtttctgggggatgaagagatggtgcgcaaagccatggaagct
gtggctgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system