KEGG   Pongo abelii (Sumatran orangutan): 100436575Help
Entry
100436575         CDS       T01416                                 

Gene name
PADI1
Definition
peptidyl arginine deiminase, type I
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100436575 (PADI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 663 aa AA seqDB search
MAPKRTVRLSLKMPTHAVCVVGVTAHVDIHSDVPKGANSFRVSGSSGVEAFMVYNRTHVT
EPMGKARWPLDTDADMVVSVGTASKELKDFKVRVSYFGEQEDQALGHSVLYLTGVDISLE
VDTSRTGKVKRSQGDKKTWRWGPEGYGAILLVNCDRDNHRSTEPDFTHSWLMSLADLQDM
SPMLLSCNGPDKLFDSHKLVLNVPFSDSKRVRVFCARGGNSLSDYKQVLGPQCLSYEVER
QLGEQEIKFYVEGLTFPDADFLGLVSLSVSLVDPGTLPEVTLFTDTVGFRMAPWIMTPNT
QPPEELYVCSVMDTHGSNEKFLEDMSYLTLKANCKLTICPQVENRNDRWIQDEMEFGYIE
APHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIPFPGPSSLDSFGNLDVSPPVTV
GGMEYPLGRILIGSSFPKSGGRQMARAVRNFLKAQQVQAPVELYSDWLSVGHVDEFLTFV
PTSDQKGFRLLLASPSACLKLFQEKKEEGYGEAAQFDGLKHQEKRSINEMLSDRHLQRDN
LHAQKCIDWNRNVLKRELGLAESDIVDIPQLFLLKNFYAEAFFPDMVNMVVLGKYLGIPK
PYGPIINGRCCLEEKVQSLLEPLGLHCIFIDDYLSYHELQGEIHCGTNVRRKPFPFKWWN
MVP
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggccccaaagagaactgtgcggctgtccctgaagatgcctacccatgccgtgtgtgtg
gtgggagtcacggcacatgtggacattcacagtgatgtgcccaagggtgccaacagcttc
agggtctctggaagctccggggtggaggccttcatggtctacaaccgcacacatgtgaca
gagcccatgggcaaggcccgttggccgctggacactgatgcagacatggtcgtgtccgtg
ggcacagccagtaaggaattaaaggacttcaaggtgagggtctcctactttggggagcag
gaagaccaagccctgggccacagcgtgctttacctcactggcgtcgatatttcccttgag
gttgacacaagccgcacaggcaaggtgaagagaagccaaggggacaagaaaacctggcgc
tggggccctgagggctatggggctatcttgctggtgaactgtgaccgggacaatcacagg
tccacggagcctgacttcacccacagctggctgatgtcgctggctgatctgcaggacatg
tccccaatgctgctgagctgcaatggccccgacaagctcttcgacagccacaagcttgtc
ttgaacgtgcccttttctgattccaaaagagtgagggtcttctgtgcccggggtgggaat
tctctctcggactacaagcaggtgctggggccccagtgtttgtcctatgaagttgagcgg
cagctgggcgagcaggagatcaagttctatgtggaggggctgaccttccccgatgccgat
ttcctggggctggtttccctcagtgtcagcctggtggacccggggaccctgcccgaggtg
accctcttcacagacactgtgggcttccgcatggcgccctggatcatgacacccaacact
cagcctcctgaggagctgtatgtgtgcagtgtgatggacactcatggctccaatgagaaa
ttcctggaggacatgtcttatctgacattgaaagccaactgcaaactgaccatctgccct
caagttgaaaatcgaaatgaccgctggatccaggacgagatggagtttggctacatcgag
gcccctcacaaatccttccctgtggtctttgactccccccggaacaggggcctgaaagat
ttcccctataagaggatcctgggtcctgactttggatatgtgacccgggagatcccattc
cctggtccctccagccttgactccttcggcaacctggacgtcagcccgcccgtcacggtg
ggcggcatggaatatcccctgggccggatcctcatcgggagcagcttccccaagtccggt
gggcggcagatggccagggcagttcggaacttcctgaaggcacagcaggtgcaggcaccc
gtggagctctactcggactggctctctgtgggccatgtggacgagtttctgacctttgtg
cctacctctgaccaaaagggcttccggctgctcctggctagccccagcgcttgcctcaaa
ctcttccaagagaagaaagaagagggctatggggaggcggcccagtttgatgggttaaaa
caccaagaaaaaagaagcattaatgagatgctgtcagacagacatctccagagagacaat
cttcatgcacagaaatgcattgactggaaccgtaatgtgctgaagcgggaactgggcctg
gcagagagtgacatcgtggacattccccagctcttcctcctgaaaaacttctacgcagaa
gccttcttcccagacatggttaacatggtggtcttaggcaagtacctgggcatccccaag
ccctacgggcccatcatcaatggccgctgctgcctggaggagaaggtgcagtccctgctg
gagcctctgggcctgcactgcatcttcattgatgactacttgtcctaccacgagctgcag
ggggagatccactgtggcaccaacgtgcgcaggaagccctttcccttcaaatggtggaac
atggtgccctga

DBGET integrated database retrieval system