KEGG   Pongo abelii (Sumatran orangutan): 100436584Help
Entry
100436584         CDS       T01416                                 

Definition
nitric oxide synthase, inducible-like
Orthology
K13241  
nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arginine and proline metabolism
Metabolic pathways
Calcium signaling pathway
HIF-1 signaling pathway
Peroxisome
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Tuberculosis
Pathways in cancer
Small cell lung cancer
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pon00330]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:pon04066]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:pon04020]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:pon04146]
Human Diseases; Cancers; Pathways in cancer [PATH:pon05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:pon05222]
Human Diseases; Infectious diseases; Salmonella infection [PATH:pon05132]
Human Diseases; Infectious diseases; Pertussis [PATH:pon05133]
Human Diseases; Infectious diseases; Tuberculosis [PATH:pon05152]
Human Diseases; Infectious diseases; Amoebiasis [PATH:pon05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:pon05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:pon05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:pon05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 1153 aa AA seqDB search
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHSLSKQQNESPQPL
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSPAREMFEHICKHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYNLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTLRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPAPHQTVRLEVLDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNNLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQRKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHEEPGHLY
VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDT
AAVQPSSLEMSVL
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtccttggaaatttctgttcaagaccaaattccaccagtatgcaatgaatggg
gaaaaagacatcaacaacaacgtggagaaagccccctgtgccacctccagtccagtgaca
caggatgacctccagtatcacagcctcagcaagcagcagaatgagtccccgcagcccctc
gtggagacgggaaagaagtctccagaatctctggtcaagctggatgcaaccccattgtcc
tccccacggcatgtgaggatcaaaaactggggcagcgggatgactttccaagacacactt
caccataaggccaaagggattttaacttgcaggtccaaatcttgcctggggtccattatg
actcccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttcta
cctcaagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagag
gaacatctggccagagtggaagcagtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccacgctgc
attgggaggatccagtggtccaacctgcaggtctttgatgcccgcagctgttcccctgcc
cgggaaatgtttgaacacatctgcaaacacgtgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagcgatggcaagcacgacttccgggtgtgg
aatgctcagctcatccgctatgctggctaccagatgccagatggcagcatcagaggggac
cctgccaacgtggaattcactcagctgtgcattgacctgggctggaagcccaagtacggc
cgctttgatgtggtccccctggtcctgcaggctgatggccgtgaccctgagctcttcgaa
attccacctgaccttgtgcttgaggtggccatggaacatcccaaatacgagtggtttcgg
gaactggagctaaagtggtacgccctgcctgcagtggccaacatgctgctcgaggtgggc
ggcctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggc
ttggaaacgcacaagctggcctcactctggaaagaccaggctgtcgttgagatcaacatt
gctgtgctccatagtttccagaagcagaatgtgaccatcatggaccaccactcggctgca
gaatccttcatgaagtacatgcagaatgaataccggtcccgtgggggctgcccggcagac
tggatttggctggtccctcccatgtctgggagcatcacccccgtgtttcaccaggagatg
ctgaactacgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtc
tggcaggacgagaagcggagacccaagagaagggagattccgttgaaagtcttggtcaaa
gctgtgctctttgcctgtatgctgatgcgcaagacaatggcgtcccgagtcagagtcacc
atcctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggccttg
ttcagctgtgccttcaaccccaaggttgtctgcatggataagtacaacctcagctgcctg
gaggaggagcggctgctgttggtggtgaccagtacgtttggcaacggagactgccccggc
aatggagagaaactgaagaaatcgctcttcatgctgaaagagctcaacaacaaattcagg
tacgctgtgtttggccttggctccagcatgtaccctcggttctgcgcctttgctcatgac
attgatcagaagctgtcccacctgggggcctctcagctcaccccgatgggagaaggggat
gagctcagtggacaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctcc
aatgtgacctgggacccgcaccactataggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcagcatgcacgccaagaacgtgttcaccctgaggctcaaatctcgg
cagaatctacaaagtccgacatccagccgtgccaccatcctggtggaactctcctgtgag
gatggccaaggcctgaactacctgccgggggagcaccttggggtttgcccaggcaaccag
ccggccctggtccaaggcatcctggagcgagtggtggacggccccgcgccccaccagaca
gtgcgcctggaggtcctggatgagagcggcagctactgggtcagtgacaagaggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcaccacacccccaacccag
ctgctgctccaaaagctggcccaggtggccacagaagagcctgagagacagaggctggag
gccttgtgtcagccctcagagtacagcaagtggaagttcaccaacagccccacgttcctg
gaggtgctagaagagttcccgtccctgcgggtgtctgctggcttcctgctttcccagctc
cccattctgaagcccaggttctactccatcagctcctcccgggatcacacgcccacggag
atccacctgactgtggccgtggtcacctaccacacccgagatggccagggtcccctgcac
cacggcgtctgcagcacatggctcaacaacctgaagccccaagacccagtgccctgcttt
gtgcggaatgccagcggcttccacctccccgaggacccctcccatccttgcatcctcatc
gggcctggcacaggcatcgctcccttccgcagtttctggcagcagcggctccatgactcc
cagcgcaagggagtgcggggaggccgcatgaccttggtgtttgggtgccgccgcccagat
gaggaccacatctaccaggaggagatgctggagatggcccagaagggggtgctgcatgcg
gtgcacacagcctattcccgcctgcctggcaagcccaaggtctatgttcaggacatcctg
cggcagcagctggccagcgaggtgctccgtgtgctccacgaggagccgggccacctctat
gtttgcggagatgtgcgcatggcccgggacgtggcccacaccctgaagcagctggtggct
gccaagctgaaattgaatgaggagcaggtcgaggactatttctttcagctcaagagccag
aagcgctatcatgaagatatctttggtgctgtatttccctacgaggcgaagaaggacacg
gcggcggtgcagcccagcagcctggagatgtcagtgctctga

DBGET integrated database retrieval system