KEGG   Pongo abelii (Sumatran orangutan): 100436584Help
Entry
100436584         CDS       T01416                                 

Definition
nitric oxide synthase, inducible-like
Orthology
K13241  
nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arginine and proline metabolism
Metabolic pathways
Calcium signaling pathway
HIF-1 signaling pathway
Peroxisome
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Tuberculosis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100436584
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100436584
   04020 Calcium signaling pathway
    100436584
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100436584
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100436584
   05222 Small cell lung cancer
    100436584
  Infectious diseases
   05132 Salmonella infection
    100436584
   05133 Pertussis
    100436584
   05152 Tuberculosis
    100436584
   05146 Amoebiasis
    100436584
   05145 Toxoplasmosis
    100436584
   05140 Leishmaniasis
    100436584
   05142 Chagas disease (American trypanosomiasis)
    100436584
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH dependent)
     100436584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 1153 aa AA seqDB search
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHSLSKQQNESPQPL
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSPAREMFEHICKHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYNLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTLRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPAPHQTVRLEVLDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNNLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQRKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHEEPGHLY
VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDT
AAVQPSSLEMSVL
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtccttggaaatttctgttcaagaccaaattccaccagtatgcaatgaatggg
gaaaaagacatcaacaacaacgtggagaaagccccctgtgccacctccagtccagtgaca
caggatgacctccagtatcacagcctcagcaagcagcagaatgagtccccgcagcccctc
gtggagacgggaaagaagtctccagaatctctggtcaagctggatgcaaccccattgtcc
tccccacggcatgtgaggatcaaaaactggggcagcgggatgactttccaagacacactt
caccataaggccaaagggattttaacttgcaggtccaaatcttgcctggggtccattatg
actcccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttcta
cctcaagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagag
gaacatctggccagagtggaagcagtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccacgctgc
attgggaggatccagtggtccaacctgcaggtctttgatgcccgcagctgttcccctgcc
cgggaaatgtttgaacacatctgcaaacacgtgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagcgatggcaagcacgacttccgggtgtgg
aatgctcagctcatccgctatgctggctaccagatgccagatggcagcatcagaggggac
cctgccaacgtggaattcactcagctgtgcattgacctgggctggaagcccaagtacggc
cgctttgatgtggtccccctggtcctgcaggctgatggccgtgaccctgagctcttcgaa
attccacctgaccttgtgcttgaggtggccatggaacatcccaaatacgagtggtttcgg
gaactggagctaaagtggtacgccctgcctgcagtggccaacatgctgctcgaggtgggc
ggcctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggc
ttggaaacgcacaagctggcctcactctggaaagaccaggctgtcgttgagatcaacatt
gctgtgctccatagtttccagaagcagaatgtgaccatcatggaccaccactcggctgca
gaatccttcatgaagtacatgcagaatgaataccggtcccgtgggggctgcccggcagac
tggatttggctggtccctcccatgtctgggagcatcacccccgtgtttcaccaggagatg
ctgaactacgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtc
tggcaggacgagaagcggagacccaagagaagggagattccgttgaaagtcttggtcaaa
gctgtgctctttgcctgtatgctgatgcgcaagacaatggcgtcccgagtcagagtcacc
atcctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggccttg
ttcagctgtgccttcaaccccaaggttgtctgcatggataagtacaacctcagctgcctg
gaggaggagcggctgctgttggtggtgaccagtacgtttggcaacggagactgccccggc
aatggagagaaactgaagaaatcgctcttcatgctgaaagagctcaacaacaaattcagg
tacgctgtgtttggccttggctccagcatgtaccctcggttctgcgcctttgctcatgac
attgatcagaagctgtcccacctgggggcctctcagctcaccccgatgggagaaggggat
gagctcagtggacaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctcc
aatgtgacctgggacccgcaccactataggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcagcatgcacgccaagaacgtgttcaccctgaggctcaaatctcgg
cagaatctacaaagtccgacatccagccgtgccaccatcctggtggaactctcctgtgag
gatggccaaggcctgaactacctgccgggggagcaccttggggtttgcccaggcaaccag
ccggccctggtccaaggcatcctggagcgagtggtggacggccccgcgccccaccagaca
gtgcgcctggaggtcctggatgagagcggcagctactgggtcagtgacaagaggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcaccacacccccaacccag
ctgctgctccaaaagctggcccaggtggccacagaagagcctgagagacagaggctggag
gccttgtgtcagccctcagagtacagcaagtggaagttcaccaacagccccacgttcctg
gaggtgctagaagagttcccgtccctgcgggtgtctgctggcttcctgctttcccagctc
cccattctgaagcccaggttctactccatcagctcctcccgggatcacacgcccacggag
atccacctgactgtggccgtggtcacctaccacacccgagatggccagggtcccctgcac
cacggcgtctgcagcacatggctcaacaacctgaagccccaagacccagtgccctgcttt
gtgcggaatgccagcggcttccacctccccgaggacccctcccatccttgcatcctcatc
gggcctggcacaggcatcgctcccttccgcagtttctggcagcagcggctccatgactcc
cagcgcaagggagtgcggggaggccgcatgaccttggtgtttgggtgccgccgcccagat
gaggaccacatctaccaggaggagatgctggagatggcccagaagggggtgctgcatgcg
gtgcacacagcctattcccgcctgcctggcaagcccaaggtctatgttcaggacatcctg
cggcagcagctggccagcgaggtgctccgtgtgctccacgaggagccgggccacctctat
gtttgcggagatgtgcgcatggcccgggacgtggcccacaccctgaagcagctggtggct
gccaagctgaaattgaatgaggagcaggtcgaggactatttctttcagctcaagagccag
aagcgctatcatgaagatatctttggtgctgtatttccctacgaggcgaagaaggacacg
gcggcggtgcagcccagcagcctggagatgtcagtgctctga

DBGET integrated database retrieval system