KEGG   Pongo abelii (Sumatran orangutan): 100436584Help
Entry
100436584         CDS       T01416                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00220  Arginine biosynthesis
pon00330  Arginine and proline metabolism
pon01100  Metabolic pathways
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04146  Peroxisome
pon04371  Apelin signaling pathway
pon04926  Relaxin signaling pathway
pon05132  Salmonella infection
pon05133  Pertussis
pon05140  Leishmaniasis
pon05142  Chagas disease (American trypanosomiasis)
pon05145  Toxoplasmosis
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    100436584 (NOS2)
   00330 Arginine and proline metabolism
    100436584 (NOS2)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100436584 (NOS2)
   04066 HIF-1 signaling pathway
    100436584 (NOS2)
   04020 Calcium signaling pathway
    100436584 (NOS2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100436584 (NOS2)
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    100436584 (NOS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100436584 (NOS2)
   05222 Small cell lung cancer
    100436584 (NOS2)
  Infectious diseases
   05132 Salmonella infection
    100436584 (NOS2)
   05133 Pertussis
    100436584 (NOS2)
   05152 Tuberculosis
    100436584 (NOS2)
   05146 Amoebiasis
    100436584 (NOS2)
   05145 Toxoplasmosis
    100436584 (NOS2)
   05140 Leishmaniasis
    100436584 (NOS2)
   05142 Chagas disease (American trypanosomiasis)
    100436584 (NOS2)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100436584 (NOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 100436584
NCBI-ProteinID: XP_024091210
Position
17
AA seq 1153 aa AA seqDB search
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHSLSKQQNESPQPL
VETGKKSPESLVKLDATALSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYNLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTLRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPAPHQTVRLEVLDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNNLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQRKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHEEPGHLY
VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDT
AAVQPSSLEMSVL
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtccttggaaatttctgttcaagaccaaattccaccagtatgcaatgaatggg
gaaaaagacatcaacaacaacgtggagaaagccccctgtgccacctccagtccagtgaca
caggatgacctccagtatcacagcctcagcaagcagcagaatgagtccccgcagcccctc
gtggagacgggaaagaagtctccagaatctctggtcaagctggatgcaaccgcattgtcc
tccccacggcatgtgaggatcaaaaactggggcagcgggatgactttccaagacacactt
caccataaggccaaagggattttaacttgcaggtccaaatcttgcctggggtccattatg
actcccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttcta
cctcaagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagag
gaacatctggccagagtggaagcagtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccacgctgc
attgggaggatccagtggtccaacctgcaggtctttgatgctcgcagctgttccactgcc
cgggaaatgtttgaacacatctgcagacacgtgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagcgatggcaagcatgacttccgggtgtgg
aatgctcagctcatccgctatgctggctaccagatgccagatggcagcatcagaggggac
cctgccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgatgtggtccccctggtcctgcaggccgatggccgtgaccctgagctcttcgaa
attccacctgaccttgtgcttgaggtggccatggaacatcccaaatacgagtggtttcgg
gaactggagctaaagtggtacgccctgcctgcagtggccaacatgctgctcgaggtgggc
ggcctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggc
ttggaaacgcacaagctggcctcgctctggaaagaccaggctgtcgttgagatcaacatt
gctgtgctccatagtttccagaagcagaatgtgaccatcatggaccaccactcggctgca
gaatccttcatgaagtacatgcagaatgaataccggtcccgtgggggctgcccggcagac
tggatttggctggtccctcccatgtctgggagcatcacccccgtgtttcaccaggagatg
ctgaactacgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtc
tggcaggacgagaagcggagacccaagagaagggagattccgttgaaagtcttggtcaaa
gctgtgctctttgcctgtatgctgatgcgcaagacaatggcgtcccgagtcagagtcacc
atcctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggccttg
ttcagctgtgccttcaaccccaaggttgtctgcatggataagtacaacctcagctgcctg
gaggaggagcggctgctgttggtggtgaccagtacgtttggcaacggagactgccccggc
aatggagagaaactgaagaaatcgctcttcatgctgaaagagctcaacaacaaattcagg
tacgctgtgtttggccttggctccagcatgtaccctcggttctgcgcctttgctcatgac
attgatcagaagctgtcccacctgggggcctctcagctcaccccgatgggagaaggggat
gagctcagtggacaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctcc
aatgtgacctgggacccgcaccactataggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcagcatgcacgccaagaacgtgttcaccctgaggctcaaatctcgg
cagaatctacaaagtccgacatccagccgtgccaccatcctggtggaactctcctgtgag
gatggccaaggcctgaactacctgccgggggagcaccttggggtttgcccaggcaaccag
ccggccctggtccaaggcatcctggagcgagtggtggacggccccgcgccccaccagaca
gtgcgcctggaggtcctggatgagagcggcagctactgggtcagtgacaagaggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcaccacacccccaacccag
ctgctgctccaaaagctggcccaggtggccacagaagagcctgagagacagaggctggag
gccttgtgtcagccctcagagtacagcaagtggaagttcaccaacagccccacgttcctg
gaggtgctagaagagttcccgtccctgcgggtgtctgctggcttcctgctttcccagctc
cccattctgaagcccaggttctactccatcagctcctcccgggatcacacgcccacggag
atccacctgactgtggccgtggtcacctaccacacccgagatggccagggtcccctgcac
cacggcgtctgcagcacatggctcaacaacctgaagccccaagacccagtgccctgcttt
gtgcggaatgccagcggcttccacctccccgaggacccctcccatccttgcatcctcatc
gggcctggcacaggcatcgctcccttccgcagtttctggcagcagcggctccatgactcc
cagcgcaagggagtgcggggaggccgcatgaccttggtgtttgggtgccgccgcccagat
gaggaccacatctaccaggaggagatgctggagatggcccagaagggggtgctgcatgcg
gtgcacacagcctattcccgcctgcctggcaagcccaaggtctatgttcaggacatcctg
cggcagcagctggccagcgaggtgctccgtgtgctccacgaggagccgggccacctctat
gtttgcggagatgtgcgcatggcccgggacgtggcccacaccctgaagcagctggtggct
gccaagctgaaattgaatgaggagcaggtcgaggactatttctttcagctcaagagccag
aagcgctatcatgaagatatctttggtgctgtatttccctacgaggcgaagaaggacacg
gcggcggtgcagcccagcagcctggagatgtcagtgctctga

DBGET integrated database retrieval system