KEGG   Pongo abelii (Sumatran orangutan): 100436588Help
Entry
100436588         CDS       T01416                                 

Definition
cytochrome c 2-like
Orthology
K08738  
cytochrome c
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100436588
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100436588
   04115 p53 signaling pathway
    100436588
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100436588
   05210 Colorectal cancer
    100436588
   05222 Small cell lung cancer
    100436588
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100436588
   05012 Parkinson's disease
    100436588
   05014 Amyotrophic lateral sclerosis (ALS)
    100436588
   05016 Huntington's disease
    100436588
  Cardiovascular diseases
   05416 Viral myocarditis
    100436588
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100436588
  Infectious diseases
   05134 Legionellosis
    100436588
   05152 Tuberculosis
    100436588
   05164 Influenza A
    100436588
   05161 Hepatitis B
    100436588
   05168 Herpes simplex infection
    100436588
   05145 Toxoplasmosis
    100436588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2B
AA seq 145 aa AA seqDB search
MGDAEAGKKTFIPKCALCHTVEKGEKHKTGPNLWGLFGXKTGKAPGFSYTEANKNKGIVW
GKETLMEYLENPKKYIPRTKYIPGTKMIFSSLKKKSEREDLIQYLKWATSSLRKFCIVAC
SLPAPMSDLFVSAFWLAKPSAFLTL
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgctgaagcaggcaagaagaccttcattccaaaatgtgctctgtgccacaca
gtggaaaaaggtgaaaaacacaagactggtccaaatctctggggcctctttggctgaaaa
acaggaaaagcaccaggattttcttatacagaggcaaacaaaaacaagggtattgtatgg
ggaaaagagactctgatggaatatttggagaacccaaagaaatatatccctcggactaaa
tatatccctggaactaaaatgatcttttctagtcttaaaaagaagagtgagagagaagat
cttattcaatatttgaaatgggcaacatcttcacttcggaaattttgtatagttgcttgc
agcctgcctgctcccatgtcagacttgttcgtgtctgcattctggcttgcgaaaccatca
gcatttcttactctctga

DBGET integrated database retrieval system