KEGG   Pongo abelii (Sumatran orangutan): 100436624Help
Entry
100436624         CDS       T01416                                 

Gene name
HDAC10
Definition
histone deacetylase 10
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:pon05203]
Human Diseases; Substance dependence; Alcoholism [PATH:pon05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
22
AA seq 646 aa AA seqDB search
MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLLLSAREASEEEL
GLVHSPEYVSLVRETQVLXXXHMHVLCAQGVICALHPQSTFHCARLAAGAGLQLVDAVLT
GAVQNGLALVRPPGHHSQRAAANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGI
QYLFEDDPSILYFSWHRYEHGRFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYV
AAFLHLLLPLAFEPTPECFAHLTQLLQVLAGGRVCAVLEGGYHLESLAESVCMTVQTLLG
DPAPPLSGSMVPCQSALESIQSARAAQAPHWKSLQLQDVTPVLMSPSILSPEERPPPLLP
GGPVCKGAASAPSSLLDQPCLCPAPSVRTAVALTAPDITLVLPPDVIQQEGSALREETEA
WARPHESLAREEALAALGKLLYLLDGMLDGQVNSGIAATPASAAAATLDVAIRRGLSHGA
QRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALSMFHVSTPLPAMTGGFLSCILGLV
LPLAYSFQPDLVLVALGPGHGLQGRHAALLAAMLRGLAGGRVLALLEEDSTPQLAGILAR
VLNGEAPPSLGASSVASPEDVRALMYLRGQLEPQWKMLQCHPHLVA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggggaccgcgcttgtgtaccatgaggacatgacggccacccggctgctctgggacgac
cccgagtgcgagattgagcgtcctgagcgcctgaccgcagccctggaccgcctgcggcag
cgcggcctggaacagaggtgtctgctgttgtcagcccgcgaggcctcggaagaggagctg
ggcctggtgcacagcccagagtatgtatccctggtcagggagacccaggtcctnnnnnnn
nnncacatgcacgtgctctgcgcgcagggggtcatctgcgccttgcacccacagagtacc
tttcactgtgcgcggctggccgcaggggctggactgcagctggtggacgctgtgctcacg
ggagctgtgcaaaatgggcttgccctggtgaggcccccagggcaccacagccagagggcg
gctgccaacgggttctgtgtgttcaacaacgtggccatagcagctgcacatgccaagcag
aaacacgggctacacaggatcctcgtcgtggactgggatgtgcatcatggccaggggatc
cagtatctctttgaggatgaccccagcatcctttacttctcctggcaccgctatgagcat
gggcgcttctggcctttcctgcgagagtcagatgccgacgcagtggggcggggacagggc
ctcggcttcactgtcaacctgccctggaaccaggtcgggatgggaaacgctgactacgtg
gctgccttcctgcacctgctgctcccactggcctttgagcccacgccagagtgcttcgcc
cacctcacacagctgctgcaggtgctggccggcggccgggtctgcgccgtgctggagggc
ggctaccacctggagtcactggcggagtcagtgtgcatgacagtacagacgctgttgggt
gacccggctccacccctgtcagggtcaatggtgccatgtcagagtgccctggagtccatc
cagagtgcccgtgctgcccaggccccgcactggaagagcctccagctgcaagatgtgacc
cctgtgctgatgagccccagcattctctccccagaggagaggcctccacctctgctgcct
gggggtccagtgtgtaagggagctgcatctgcaccgagctccctcctggaccagccgtgc
ctctgccctgcaccctctgtccgcaccgctgttgccctgacagcaccagatatcacattg
gtcctgccccctgacgtcatccaacaggaagggtcagccctaagggaggagacagaagcc
tgggccaggccacacgagtccctggcccgggaggaggccctcgctgcacttgggaagctc
ctgtacctcttagatgggatgctggatgggcaggtgaacagtggtatagcagccactcca
gcctctgctgcagcagccaccctggatgtggctattcggagaggcctgtctcatggagcc
cagaggctgctgtgtgtggccctgggacagctggaccggcctccggacctcgcccatgac
gggaggagtctgtggctgaacatcaggggcaaggaggcggctgccctatccatgttccat
gtctccacgccactgccagcgatgaccggtggtttcctgagctgcatcttgggcttggtg
ctgcccctggcctacagcttccagcctgacctggtgctggtggcgctggggcctggccat
ggcctgcagggccgccacgctgcactcctggctgcaatgcttcgggggctggcagggggc
cgagtcctggccctcctggaggaggactccacgccccagctagcagggatcctggcccgg
gtgctgaatggagaggcacctcctagcctaggcgcttcctctgtggcctccccagaggac
gtccgggctctgatgtacctgagagggcagctggagcctcagtggaagatgttgcagtgc
catcctcacctggtggcttga

DBGET integrated database retrieval system