KEGG   Pongo abelii (Sumatran orangutan): 100436624Help
Entry
100436624         CDS       T01416                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10 isoform X1
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05034  Alcoholism
pon05165  Human papillomavirus infection
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100436624 (HDAC10)
  Substance dependence
   05034 Alcoholism
    100436624 (HDAC10)
  Infectious diseases
   05165 Human papillomavirus infection
    100436624 (HDAC10)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100436624 (HDAC10)
Chromosome [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100436624 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100436624
NCBI-ProteinID: XP_024095930
Ensembl: ENSPPYG00000011979
Position
22
AA seq 670 aa AA seqDB search
MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLLLSAREASEEEL
GLVHSPEYVSLVRETQVLGKEELQALSGQFDAICFHPSTFHCARLAAGAGLQLVDAVLTG
AVQNGLALVRPPGHHSQRAAANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQ
YLFEDDPSILYFSWHRYEHGRFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVA
AFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV
LEGGYHLESLAESVCMTVQTLLGDPAPPLSGSMVPCQSALESIQSARAAQAPHWKSLQLQ
DVTPVLMSPSILSPEERPPPLLPGGPVCKGAASAPSSLLDQPCLCPAPSVRTAVALTAPD
ITLVLPPDVIQQEGSALREETEAWARPHESLAREEALAALGKLLYLLDGMLDGQVNSGIA
ATPASAAAATLDVAIRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALS
MFHVSTPLPAMTGGFLSCILGLVLPLAYSFQPDLVLVALGPGHGLQGRHAALLAAMLRGL
AGGRVLALLEEDSTPQLAGILARVLNGEAPPSLGASSVASPEDVRALMYLRGQLEPQWKM
LQVGAFTPQK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggggaccgcgcttgtgtaccatgaggacatgacggccacccggctgctctgggacgac
cccgagtgcgagattgagcgtcctgagcgcctgaccgcagccctggaccgcctgcggcag
cgcggcctggaacagaggtgtctgctgttgtcagcccgcgaggcctcggaagaggagctg
ggcctggtgcacagcccagagtatgtatccctggtcagggagacccaggtcctaggcaag
gaggagctgcaggcgctgtccggacagttcgacgccatctgcttccacccgagtaccttt
cactgtgcgcggctggccgcaggggctggactgcagctggtggacgctgtgctcacggga
gctgtgcaaaatgggcttgccctggtgaggcccccagggcaccacagccagagggcggct
gccaacgggttctgtgtgttcaacaacgtggccatagcagctgcacatgccaagcagaaa
cacgggctacacaggatcctcgtcgtggactgggatgtgcatcatggccaggggatccag
tatctctttgaggatgaccccagcatcctttacttctcctggcaccgctatgagcatggg
cgcttctggcctttcctgcgagagtcagatgccgacgcagtggggcggggacagggcctc
ggcttcactgtcaacctgccctggaaccaggtcgggatgggaaacgctgactacgtggct
gccttcctgcacctgctgctcccactggcctttgagtttgaccctgagctggtgctggtc
tcggcaggatttgactcagccatcggggaccctgaggggcaaatgcaggccacgccagag
tgcttcgcccacctcacacagctgctgcaggtgctggccggcggccgggtctgcgccgtg
ctggagggcggctaccacctggagtcactggcggagtcagtgtgcatgacagtacagacg
ctgttgggtgacccggctccacccctgtcagggtcaatggtgccatgtcagagtgccctg
gagtccatccagagtgcccgtgctgcccaggccccgcactggaagagcctccagctgcaa
gatgtgacccctgtgctgatgagccccagcattctctccccagaggagaggcctccacct
ctgctgcctgggggtccagtgtgtaagggagctgcatctgcaccgagctccctcctggac
cagccgtgcctctgccctgcaccctctgtccgcaccgctgttgccctgacagcaccagat
atcacattggtcctgccccctgacgtcatccaacaggaagggtcagccctaagggaggag
acagaagcctgggccaggccacacgagtccctggcccgggaggaggccctcgctgcactt
gggaagctcctgtacctcttagatgggatgctggatgggcaggtgaacagtggtatagca
gccactccagcctctgctgcagcagccaccctggatgtggctattcggagaggcctgtct
catggagcccagaggctgctgtgtgtggccctgggacagctggaccggcctccggacctc
gcccatgacgggaggagtctgtggctgaacatcaggggcaaggaggcggctgccctatcc
atgttccatgtctccacgccactgccagcgatgaccggtggtttcctgagctgcatcttg
ggcttggtgctgcccctggcctacagcttccagcctgacctggtgctggtggcgctgggg
cctggccatggcctgcagggccgccacgctgcactcctggctgcaatgcttcgggggctg
gcagggggccgagtcctggccctcctggaggaggactccacgccccagctagcagggatc
ctggcccgggtgctgaatggagaggcacctcctagcctaggcgcttcctctgtggcctcc
ccagaggacgtccgggctctgatgtacctgagagggcagctggagcctcagtggaagatg
ttgcaggtgggagcatttacaccgcagaaatga

DBGET integrated database retrieval system