KEGG   Pongo abelii (Sumatran orangutan): 100436725Help
Entry
100436725         CDS       T01416                                 

Gene name
ALPP
Definition
alkaline phosphatase, placental
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pon00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2B
AA seq 535 aa AA seqDB search
MRGPCVLLLLLLLCLKLQLSLCIIPVEEENPDFWNRQAAEALGAAKKLQPVQTAAKNLII
FLGDGMGVSTVTAARILKGHKKDKLGPEIPLAMDRFPYVALSKTYSVDKHVPDSAATATA
YLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAG
AYAHTVNRSWYSDANMPCSARREGCKDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYP
DDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI
HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAI
ERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG
YVLKDGARPDVTESESESPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFV
AHVMAFAACLEPYTACDLAPTAGTTDAAHPGSSSVPASLPLLAGTLLLPETATAL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgcgggggccctgtgtgctgctgctgctgctgctgctgtgcctgaagctacagctctcc
ctgtgcatcatcccagttgaggaggagaacccggacttctggaaccgccaggcagccgag
gccctgggtgctgccaagaagctgcagcccgtacagacagctgccaagaacctcatcatc
ttcctgggcgatgggatgggagtgtctacggtgacagctgcccggatcctaaaggggcac
aagaaggacaaactggggcctgagatccccctggccatggaccgcttcccatacgtggct
ctgtccaagacatacagtgtagacaaacatgtgccagacagcgcagccacagccacggcc
tacctgtgcggggtcaagggcaacttccagaccatcggcttgagtgcagccgcccgcttt
aaccagtgcaacacgacacgcggcaacgaggtcatctccgtgatgaatcgggccaagaaa
gcagggaagtcagtgggagtggtgaccaccacacgggtgcagcacgcctcgccagccggc
gcctacgcccacacggtgaaccgcagctggtactcggacgccaacatgccttgctcggcc
cgccgggagggctgcaaggacatcgccacgcagctcatctccaacatggacattgatgtg
atcctaggtggaggccgaaagtacatgtttcccatggggaccccagaccctgagtaccca
gatgactacagccaaggtgggaccaggctggatgggaagaatctggtgcaggaatggctg
gcaaagcaccagggtgcccggtatgtgtggaaccgcactgagctcatgcaggcgtccctg
gacccgtctgtgacccatctcatgggtctctttgagcccggagacatgaaatacgagatc
caccgagactccacactggacccctccctgatggagatgactgaggctgccctgcgcctg
ctgagcaggaacccccgcggcttcttcctcttcgtggagggcggtcgcatcgaccatggc
catcatgaaagcagggcttaccgggcactgactgagacgatcatgttcgacgacgccatt
gagagggcgggccagctcaccagcgaggaggacacgctgagcctcgtcactgctgaccac
tcccacgtcttctccttcggaggctaccccctgcgagggagctccatcttcgggctggcc
cctggcaaggcccgggacaggaaggcctacacggtcctcctctacggaaacggtccgggc
tatgtgctcaaggacggcgcccggccggatgttaccgagagcgagagcgagagccccgag
tatcggcagcagtcagcagtgcccctggatgaagagacccacgcaggcgaggacgtggcg
gtgttcgcgcgcggcccgcaggcgcacctggttcacggcgtgcaggagcagacctttgta
gcgcacgtcatggccttcgccgcctgcctggagccctacacggcctgcgacctggcgccc
accgccggcaccaccgacgccgcgcacccggggtcgtcctcggtccccgcttcgctgcct
ctgctggccgggaccctgctgctgccggagacggccactgctctctga

DBGET integrated database retrieval system