KEGG   Pongo abelii (Sumatran orangutan): 100436782Help
Entry
100436782         CDS       T01416                                 

Definition
cytochrome P450 3A4-like
Orthology
K17689  
cytochrome P450, family 3, subfamily A, polypeptide 4 [EC:1.14.13.32 1.14.13.67 1.14.13.97 1.14.13.157 1.14.13.-]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100436782
   00591 Linoleic acid metabolism
    100436782
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100436782
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100436782
   00982 Drug metabolism - cytochrome P450
    100436782
   00983 Drug metabolism - other enzymes
    100436782
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100436782
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     100436782
    1.14.13.67  quinine 3-monooxygenase
     100436782
    1.14.13.97  taurochenodeoxycholate 6alpha-hydroxylase
     100436782
    1.14.13.157  1,8-cineole 2-exo-monooxygenase
     100436782
    1.14.13.-  
     100436782
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP3 family
   100436782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 503 aa AA seqDB search
MDLIPDLAMETWILLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPLLGNVFSYRKGFWRF
DMECHKKYGKVWGFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIARYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSIIVFPFLTPILEILNISV
FPREVTSFLRKSVKRMKESRLKDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIMYELATHPDVQRKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHHDPKYWTEPGKFLPERFS
KKNKDNIEPYVYTPFGTGPRNCIGMRFALMNMKLAVIRVLQNFSFKPCKETQIPLKLRLG
GLLQTEKPIVLKVESRDGTLSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcccagacttggccatggaaacctggattcttctggctgtcagcctggtg
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgcctcttttgggaaatgttttttcctaccgtaagggcttttggaggttt
gacatggaatgtcataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaaccttcaccagtgga
aaactcaaggagatggtccctatcattgcccggtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaagacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccacaa
gaccccttcgtggaaaacaccaagaagcttttaagatttgatttcttggatccattcttt
ctctcaataatagtctttccattcctcaccccaattcttgaaatattaaatatctctgta
tttccaagagaagttacaagttttttaagaaaatctgtaaaaaggatgaaagaaagtcgc
ctcaaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagaaactgagtcccacaaagctctgtctgatctggagctcgtggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatgtatgaa
ctggccactcaccctgatgtccagcggaaactgcaggaggaaattgatgcagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatcttgacatggtggtg
aatgaaacgctcagattattcccaattgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatgttcattcccaaaggggtggtggtgatgattccaagctatgct
cttcaccatgacccaaagtactggacagagcctgggaagttcctccctgaaagattcagc
aagaagaacaaggacaacatagaaccttacgtatacacaccctttggaactggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctgtaatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgcttagga
ggacttcttcaaacagaaaaacccattgttctaaaggttgagtcaagggatggcacctta
agtggagcctga

DBGET integrated database retrieval system