KEGG   Pongo abelii (Sumatran orangutan): 100436782Help
Entry
100436782         CDS       T01416                                 

Definition
cytochrome P450 3A4-like
Orthology
K17689  
cytochrome P450, family 3, subfamily A, polypeptide 4 [EC:1.14.13.32 1.14.13.67 1.14.13.97 1.14.13.157 1.14.13.-]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:pon00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:pon00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:pon00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:pon00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:pon00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:pon00983]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:pon05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 503 aa AA seqDB search
MDLIPDLAMETWILLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPLLGNVFSYRKGFWRF
DMECHKKYGKVWGFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIARYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSIIVFPFLTPILEILNISV
FPREVTSFLRKSVKRMKESRLKDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIMYELATHPDVQRKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHHDPKYWTEPGKFLPERFS
KKNKDNIEPYVYTPFGTGPRNCIGMRFALMNMKLAVIRVLQNFSFKPCKETQIPLKLRLG
GLLQTEKPIVLKVESRDGTLSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcccagacttggccatggaaacctggattcttctggctgtcagcctggtg
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgcctcttttgggaaatgttttttcctaccgtaagggcttttggaggttt
gacatggaatgtcataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaaccttcaccagtgga
aaactcaaggagatggtccctatcattgcccggtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaagacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccacaa
gaccccttcgtggaaaacaccaagaagcttttaagatttgatttcttggatccattcttt
ctctcaataatagtctttccattcctcaccccaattcttgaaatattaaatatctctgta
tttccaagagaagttacaagttttttaagaaaatctgtaaaaaggatgaaagaaagtcgc
ctcaaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagaaactgagtcccacaaagctctgtctgatctggagctcgtggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatgtatgaa
ctggccactcaccctgatgtccagcggaaactgcaggaggaaattgatgcagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatcttgacatggtggtg
aatgaaacgctcagattattcccaattgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatgttcattcccaaaggggtggtggtgatgattccaagctatgct
cttcaccatgacccaaagtactggacagagcctgggaagttcctccctgaaagattcagc
aagaagaacaaggacaacatagaaccttacgtatacacaccctttggaactggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctgtaatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgcttagga
ggacttcttcaaacagaaaaacccattgttctaaaggttgagtcaagggatggcacctta
agtggagcctga

DBGET integrated database retrieval system