KEGG   Pongo abelii (Sumatran orangutan): 100436976Help
Entry
100436976         CDS       T01416                                 

Gene name
FLNB
Definition
(RefSeq) filamin-B isoform X1
  KO
K04437  filamin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04510  Focal adhesion
pon05132  Salmonella infection
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100436976 (FLNB)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100436976 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100436976 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    100436976 (FLNB)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100436976 (FLNB)
  Intermediate filaments
   Intermediate filament-binding proteins
    100436976 (FLNB)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100436976 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filamin CH Y_Y_Y Big_3_5 Invasin_D3
Motif
Other DBs
NCBI-GeneID: 100436976
NCBI-ProteinID: XP_024100015
Ensembl: ENSPPYG00000013765
Position
3
AA seq 2602 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEAAGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKVFFAGDTIPKSPFIVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRESSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDLGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPTRVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQE
GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTSEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGITG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPN
HIAGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaccgagaaggatctggcggaggacgcgccttggaagaagatccagcagaac
acgttcacacgctggtgcaacgagcacctcaagtgcgtgaacaaacgcatcggcaacctg
cagaccgacctgagcgacgggctgcggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagtaccatcagcggcccacctttcgccagatgcagctcgagaatgtg
tccgtggcgctcgagttcctggaccgtgagagcatcaagctcgtgtccatcgatagcaaa
gccattgtggatgggaacctgaagctcatcttgggtctggtgtggacgctgatcctccac
tactccatctccatgcccgtgtgggaggatgaaggggatgatgatgccaagaagcagacg
ccaaagcagaggctgctggggtggattcagaacaagatcccctacttgcccatcaccaac
tttaaccagaactggcaagacggcaaagccctcggagccctggtagacagctgtgctcca
ggtctgtgcccagactgggaatcctgggacccgcagaagcctgtggataatgcacgagaa
gccatgcagcaggcagatgactggctgggtgtcccacaggtcatcactcctgaagaaatc
attcacccggatgtggacgagcactcagttatgacttacctgtcccagttccccaaagcc
aagctcaagccgggggctcctctcaaacccaaactcaacccgaagaaagccagggcctat
ggcagaggaatcgagcccactggaaacatggtgaagcagccagccaagttcactgtggac
accatcagtgccgggcaaggagacgtgatggtgtttgttgaggacccagaagggaacaaa
gaggaggcacaagtgacccctgacagcgacaagaacaagacatactctgtggagtatctg
cccaaggtcaccgggctacacaaagtcacagtcctctttgcaggacagcacatctccaag
agcccatttgaagtgaatgttgacaaggcccagggagacgccagtaaagtcactgcaaaa
ggtccagggttggaagctgcagggaacatcgccaataagcccacctactttgacatctac
acggcaggagctggtgtgggtgacattggtgtggaggtggaagatccccaggggaagaac
accgtggagttgctcgtggaagacaaaggaaaccaggtgtatcgatgtgtgtacaaaccc
atgcagcctggcccccacgtggtcaaggtcttctttgctggggacactattcctaagagt
cccttcattgtgcaggttggggaagcctgcaatccaaatgcctgccgggccagtggccga
ggcctacaacccaaaggcgtccgtatccgggagaccacagatttcaaggttgacaccaaa
gctgcaggaagtggggagctcggtgtaaccatgaagggtcctaagggtctggaggagctg
gtgaagcagaaagactttctggatggggtctacgcattcgagtattaccccagcaccccg
gggagatacagcattgccatcacatgggggggacaccacattccaaagagcccctttgaa
gttcaagttggccccgaagcgggtatgcagaaagtccgtgcttggggccctgggctccat
ggtgggattgtcgggcggtcggcggatttcgtggtggaatccattggctctgaagtgggg
tcgctggggtttgccattgaaggcccctctcaggcaaagattgagtacaacgaccagaat
gatggatcgtgtgatgtcaaatactggcccaaggagcctggcgaatatgctgttcacatc
atgtgtgacgacgaagacatcaaggacagcccgtacatggccttcatccacccagccacg
ggagactacaaccctgatctggttcgagcatacgggccaggtttggagaaatctgggtgc
attgtcaacaacctggccgagttcaccgtggatcctaaggatgctggaaaagctccctta
aagatatttgctcaggatggggaaggccaacgcattgacatccagatgaagaaccggatg
gacggcacatatgcgtgctcatacaccccggtgaaggccatcaagcacaccattgctgtg
gtctggggaggcgtgaacatcccgcacagcccctacagggtcaacatcgggcaaggtagc
catcctcagaaggtcaaagtgtttgggccaggtgtggagagaagtggtctgaaggcaaat
gaacctacacacttcacagtggactgtactgaggctggggaaggtgatgtcagcgttggc
attaagtgtgatgcccgggtgttaagtgaagatgaggaagacgtggattttgacattatt
cacaatgccaatgatacgttcacggtcaaatatgtgcctcctgccgctgggcgatacact
atcaaagttctctttgcatctcaggaaatccctgccagtcctttcagagtcaaagttgac
ccttcccacgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaatgggaaaccgacccacttcactgtctacaccaagggggctgggaaagccccgctc
aacgtgcagttcaacagcccccttcctggcgatgcagtgaaggatttggatatcatcgat
aattacgactactctcacacggttaaatatacacccacccaacagggcaacatgcaggtt
ctggtgacttacggtggcgatcccatccctaaaagccctttcactgtgggtgttgctgca
ccgctggatctgagcaagataaaactcaatgggctggaaaacagggtggaagttgggaag
gatcaggagttcaccgttgataccaggggggcaggaggccaggggaagctggacgtgaca
atcctcagcccctctcggaaggtcgtgccatgcctagtgacacctgtgacaggccgggag
agcagcacggccaagttcatccctcgggaggaagggctgtatgctgtagacgtgacctac
gatggacaccctgtgcccgggagcccctacacagtggaggcctcgctgccaccagatccc
accaaggtgaaggcccacggtcccggcctcgaaggtggtctcgtgggcaagcctgccgag
ttcaccattgataccaaaggagctggtactggaggtctgggcttaacggtggaaggtccg
tgcgaggccaaaatcgagtgctccgacaatggtgacgggacctgctccgtctcttacctt
cccacgaaacccggggagtacttcgtcaacatcctctttgaagaagtccacatacctggg
tctcccttcaaagccgacattgaaatgccctttgacccctctaaagtcgtggcatcgggg
ccaggtctcgagcatgggaaggtgggtgaagctggcctccttagcgtcgactgctcggaa
gcgggaccgggggccctgggcctggaagctgtctcggacttgggaacaaaagccgaagtc
agtattcagaacaacaaagatggcacctatgcagtgacctacgtgcccctgacggccggc
atgtacacgttgaccatgaagtatggtggcgaacttgtgccacacttccccacccgggtc
aaggtggagcccgctgtggacaccagcaggatcaaagtctttggaccaggaatagaaggg
aaagatgtgttccgggaagccaccaccgactttacagttgactctcggccgctgacccag
gttgggggtgaccacatcaaggcccacattgccaacccctcaggggcctccaccgagtgc
tttgtcacagacaatgctgatgggacctaccaggtggaatacacaccctttgagaaaggt
ctccatgtagtagaggtgacatatgatgatgtgcctatcccaaacagtcccttcaaggtg
gctgtcactgaaggctgccaaccatctagggtgcaagcccaaggacctggattgaaagag
gcctttaccaacaagcccaatgtcttcaccgtggttaccagaggggcaggaattggtggg
cttggcataactgttgagggaccatcagagtcgaagataaattgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgctccgggggattatgatgttaatatcaca
tatggaggagcccacatccctggcagccccttcagggttcctgtgaaggatgttgtggac
cccagcaaggtcaagattgccggccccgggctaggctcaggcgtccgagcccgtgtcctg
cagtccttcacggtggacagcagcaaggctggcctggctccgctggaagtgagggtcctg
ggcccacgaggcctggtggagccagtgaacgtggtggacaatggagatggcacacacaca
gtaacctataccccatctcaggagggaccttacatggtctcagttaaatatgctgatgaa
gagattcctcgcagtcccttcaaggtcaaggtccttcccacatatgacgccagcaaagtg
accgccagtggccccggccttagttcctatggtgtgcctgccagtctacctgtggacttt
gcaattgatgcccgagatgccggggaaggcctgcttgctgttcaaataacggaccaagaa
ggaaaacccaaaagagccattgtccatgacaataaagatggcacgtatgctgtcacctac
atccccgacaagactggacgctatatgattggggtcacctatgggggtgacaacattcca
ctttctccttatcgcatccgagccacacagacgggtgatgccagcaagtgcctggccacg
ggtcctggaatcgcctccactgtgaaaactagcgaagaagtaggctttgtggttgatgcc
aagactgccgggaaggggaaagtgacctgcacggttctgaccccagatggcactgaggcc
gaggccgatgtcattgagaatgaagatggaacctatgacatcttctacacagctgccaaa
ccgggcacatatgtgatctatgtgcgctttggtggtgttgatattcctaacagccccttc
actgtcatggccacagatggggaagtcacagccgtggaggaggcaccggtaaatgcatgt
ccccctggattcaggccctgggtgaccgaagaggcctatgtcccagtgagtgatatgaac
ggcctgggatttaagccttttgacctggtcattccgtttgctgtcaggaaaggagaaatc
accggagaggtccacatgccttctgggaagacagccacacctgagattgtggacaacaag
gacggcacggtcactgttagatacgcccccactgaggtcgggctccatgagatgcacatc
aaatacatgggcagccacatccctgagagcccactccagttctacgtgaattaccccaac
agtggaagcgtttctgcatacggtccaggcctcgtgtatggagtggccaacaaaactgcc
accttcaccatcgtcacggaggatgcaggagaaggtggtctggacttggctattgagggc
ccctcaaaagcagaaatcagctgcatcgacaacaaagatgggacatgcacagtgacctac
ctgcccactctgccaggcgactacagcattctggtcaagtacaatgacaagcacatccct
ggcagccccttcacagccaagatcacagatgacagcaggcggtgctcccaggtgaagttg
ggctcggccgctgacttcctgctcgacatcagtgagactgacctcagcagcctgacggcc
agcattaaggccccatctggccgagatgagccctgtctcctgaagaggctgcccaacaac
cacattggcatctccttcatcccccgggaagtgggtgaacacctggtcagcatcaagaaa
aatggcaaccatgtggccaacagccccgtgtccatcatggtggtccagtccgagattggt
gatgcccgccgagccaaagtctatggccgtggcctgtcagaaggccggactttcgagatg
tctgacttcatcgtggacacaagggatgcaggttatggtggcatatccttggcggtggaa
ggccccagcaaagtggacatccagactgaagacctggaagatggcacctgcaaagtctcc
tacttccccaccgtgcctggggtttatattgtctccaccaaattcgctgacgagcacgtg
cctgggagcccatttaccgtgaagatcagcggggagggaagagtcaaagagagcatcacc
cgcaccagtcgggccccgtctgtggccactgtcgggagcatctgtgacctgaacctgaaa
atcccagaaatcaacagcagtgatatgtcggcccacgtcaccagcccctctggccgtgtg
actgaggcagagattgtgcccatggggaagaactcgcactgcgtccggtttgtgccccag
gagatgggcgtgcacacggtcagcgtcaagtaccgtgggcagcacgtcaccggcagcccc
ttccagttcaccgtggggccacttggtgaaggaggcgcccacaaggtgcgggcaggaggc
cctggcctggagagaggagaagcgggagtcccagctgagttcagcatttggacccgggaa
gcaggcgctggaggcctctccatcgctgttgagggccccagtaaggccgagattacattt
gatgaccataaaaatgggtcatgcggtgtgtcttatattgcccaagagcctggtaactac
gaggtgtccatcaaattcaatgatgagcacatcccggaaagcccctacctggtgccggtc
atcgcgccctccgacgacgcccgccgcctcactgttatgagccttcaggaatcgggatta
aaagttaaccagccagcatcctttgctataaggttgaatggcgcaaaaggcaagattgat
gcaaaggtgcacagcccctctggagccgtggaggagtgccacgtgtctgagctggagcca
gataagtatgctgttcgcttcattcctcatgagaatggtgtccacaccatcgatgtcaag
ttcaatgggagccacgtggttggaagccccttcaaagtgcgcgttggggagcctggacaa
gcgggcaaccctgccctggtgtccgcctatggcacgggactcgaagggggcatcacaggt
atccagtcggaattctttattaacaccacccgagcaggtccagggacattatccgtcacc
atcgaaggcccgtccaaggttaaaatggattgtcaggaaacacctgaaggatacaaagtc
atgtacacccccatggctcctggtaactacctgatcagtgtcaaatacggtgggcccaac
cacatcgcgggcagtcccttcaaggccaaggtgacaggccagcgtctagttagccccggc
tcagccaatgagacctcatccatcctggtggagtcagtgaccaggtcttctacagagacc
tgctatagcgccattcccaaggcatcctcggacgccagcaaggtgacctctaagggtgca
gggctctccaaggcctttgtgggccagaagagttccttcctggtggactgcagcaaagcc
ggctccaacatgctgctgatcggggtccatgggcccaccaccccctgtgaggaggtctcc
atgaagcatgtaggcaaccagcaatacaacgtcacatatgtcgtcaaggagaggggcgat
tatgtgctggctgtgaagtggggggaggaacacatccctggcagcccttttcatgtcaca
gtgccttaa

DBGET integrated database retrieval system