KEGG   Pongo abelii (Sumatran orangutan): 100436976Help
Entry
100436976         CDS       T01416                                 

Gene name
FLNB
Definition
filamin B, beta
Orthology
K04437  
filamin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100436976 (FLNB)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100436976 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100436976 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    100436976 (FLNB)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100436976 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 2658 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEAAGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKVFFAGDTIPKSPFIVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRESSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDLGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPTRVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRADDMDSQSWRSPLKALSEFFKGDPKGDFNKIGLVEPV
NVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSS
YGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYM
IGVTYGGDNIPLSPYRIRATQTGDASKCLATGPGIASTVKTSEEVGFVVDAKTAGKGKVT
CTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEV
TAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSG
KTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGP
GLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYS
ILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRD
EPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYG
RGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVY
IVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDM
SAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLG
EGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCG
VSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFA
IRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGS
PFKVRVGEPGQAGNPALVSAYGTGLEGGITGIQSEFFINTTRAGPGTLSVTIEGPSKVKM
DCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIAGSPFKAKVTGNDQPSSELLSLPGELG
EVRFQSKVTQVASGRAGIRTHTVRVYEPLLVIATLSHLSGAPALLRKHLTFGSHTPSFSC
ACPDTSGWSNHFFCLLGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLA
VKWGEEHIPGSPFHVTVP
NT seq 7977 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaccgagaaggatctggcggaggacgcgccttggaagaagatccagcagaac
acgttcacacgctggtgcaacgagcacctcaagtgcgtgaacaaacgcatcggcaacctg
cagaccgacctgagcgacgggctgcggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagtaccatcagcggcccacctttcgccagatgcagctcgagaatgtg
tccgtggcgctcgagttcctggaccgtgagagcatcaagctcgtgtccatcgatagcaaa
gccattgtggatgggaacctgaagctcatcttgggtctggtgtggacgctgatcctccac
tactccatctccatgcccgtgtgggaggatgaaggggatgatgatgccaagaagcagacg
ccaaagcagaggctgctggggtggattcagaacaagatcccctacttgcccatcaccaac
tttaaccagaactggcaagacggcaaagccctcggagccctggtagacagctgtgctcca
ggtctgtgcccagactgggaatcctgggacccgcagaagcctgtggataatgcacgagaa
gccatgcagcaggcagatgactggctgggtgtcccacaggtcatcactcctgaagaaatc
attcacccggatgtggacgagcactcagttatgacttacctgtcccagttccccaaagcc
aagctcaagccgggggctcctctcaaacccaaactcaacccgaagaaagccagggcctat
ggcagaggaatcgagcccactggaaacatggtgaagcagccagccaagttcactgtggac
accatcagtgccgggcaaggagacgtgatggtgtttgttgaggacccagaagggaacaaa
gaggaggcacaagtgacccctgacagcgacaagaacaagacatactctgtggagtatctg
cccaaggtcaccgggctacacaaagtcacagtcctctttgcaggacagcacatctccaag
agcccatttgaagtgaatgttgacaaggcccagggagacgccagtaaagtcactgcaaaa
ggtccagggttggaagctgcagggaacatcgccaataagcccacctactttgacatctac
acggcaggagctggtgtgggtgacattggtgtggaggtggaagatccccaggggaagaac
accgtggagttgctcgtggaagacaaaggaaaccaggtgtatcgatgtgtgtacaaaccc
atgcagcctggcccccacgtggtcaaggtcttctttgctggggacactattcctaagagt
cccttcattgtgcaggttggggaagcctgcaatccaaatgcctgccgggccagtggccga
ggcctacaacccaaaggcgtccgtatccgggagaccacagatttcaaggttgacaccaaa
gctgcaggaagtggggagctcggtgtaaccatgaagggtcctaagggtctggaggagctg
gtgaagcagaaagactttctggatggggtctacgcattcgagtattaccccagcaccccg
gggagatacagcattgccatcacatgggggggacaccacattccaaagagcccctttgaa
gttcaagttggccccgaagcgggtatgcagaaagtccgtgcttggggccctgggctccat
ggtgggattgtcgggcggtcggcggatttcgtggtggaatccattggctctgaagtgggg
tcgctggggtttgccattgaaggcccctctcaggcaaagattgagtacaacgaccagaat
gatggatcgtgtgatgtcaaatactggcccaaggagcctggcgaatatgctgttcacatc
atgtgtgacgacgaagacatcaaggacagcccgtacatggccttcatccacccagccacg
ggagactacaaccctgatctggttcgagcatacgggccaggtttggagaaatctgggtgc
attgtcaacaacctggccgagttcaccgtggatcctaaggatgctggaaaagctccctta
aagatatttgctcaggatggggaaggccaacgcattgacatccagatgaagaaccggatg
gacggcacatatgcgtgctcatacaccccggtgaaggccatcaagcacaccattgctgtg
gtctggggaggcgtgaacatcccgcacagcccctacagggtcaacatcgggcaaggtagc
catcctcagaaggtcaaagtgtttgggccaggtgtggagagaagtggtctgaaggcaaat
gaacctacacacttcacagtggactgtactgaggctggggaaggtgatgtcagcgttggc
attaagtgtgatgcccgggtgttaagtgaagatgaggaagacgtggattttgacattatt
cacaatgccaatgatacgttcacggtcaaatatgtgcctcctgccgctgggcgatacact
atcaaagttctctttgcatctcaggaaatccccgccagtcctttcagagtcaaagttgac
ccttcccacgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaatgggaaaccgacccacttcactgtctacaccaagggggctgggaaagccccgctc
aacgtgcagttcaacagcccccttcctggcgatgcagtgaaggatttggatatcatcgat
aattacgactactctcacacggttaaatatacacccacccaacagggcaacatgcaggtt
ctggtgacttacggtggcgatcccatccctaaaagccctttcactgtgggtgttgctgca
ccgctggatctgagcaagataaaactcaatgggctggaaaacagggtggaagttgggaag
gatcaggagttcaccgttgataccaggggggcaggaggccaggggaagctggacgtgaca
atcctcagcccctctcggaaggtcgtgccatgcctagtgacacctgtgacaggccgggag
agcagcacggccaagttcatccctcgggaggaagggctgtatgctgtagacgtgacctac
gatggacaccctgtgcccgggagcccctacacagtggaggcctcgctgccaccagatccc
accaaggtgaaggcccacggtcccggcctcgaaggtggtctcgtgggcaagcctgccgag
ttcaccattgataccaaaggagctggtactggaggtctgggcttaacggtggaaggtccg
tgcgaggccaaaatcgagtgctccgacaatggtgacgggacctgctccgtctcttacctt
cccacgaaacccggggagtacttcgtcaacatcctctttgaagaagtccacatacctggg
tctcccttcaaagccgacattgaaatgccctttgacccctctaaagtcgtggcatcgggg
ccaggtctcgagcatgggaaggtgggtgaagctggcctccttagcgtcgactgctcggaa
gcgggaccgggggccctgggcctggaagctgtctcggacttgggaacaaaagccgaagtc
agtattcagaacaacaaagatggcacctatgcagtgacctacgtgcccctgacggccggc
atgtacacgttgaccatgaagtatggtggcgaacttgtgccacacttccccacccgggtc
aaggtggagcccgccgtggacaccagcaggatcaaagtctttggaccaggaatagaaggg
aaagatgtgttccgggaagccaccaccgactttacagttgactctcggccgctgacccag
gttgggggtgaccacatcaaggcccacattgccaacccctcaggggcctccaccgagtgc
tttgtcacagacaatgctgatgggacctaccaggtggaatacacaccctttgagaaaggt
ctccatgtagtggaggtgacatatgatgatgtgcctatcccaaacagtcccttcaaggtg
gctgtcactgaaggctgccaaccatctagggtgcaagcccaaggacctggattgaaagag
gcctttaccaacaagcccaatgtcttcaccgtggttaccagaggggcaggaattggtggg
cttggcataactgttgagggaccatcagagtcgaagataaattgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgctccgggggattatgatgttaatatcaca
tatggaggagcccacatccctggcagccccttcagggttcctgtgaaggatgttgtggac
cccagcaaggtcaagattgccggccccgggctaggctcaggcgtccgagcccgtgtcctg
cagtccttcacggtggacagcagcaaggctggcctggctccgctggaagtgagggtcctg
ggcccacgagctgatgacatggattcccagtcatggcgcagccccttgaaagccctttca
gagttctttaaaggtgacccaaagggtgactttaataagataggcctggtggagccagtg
aacgtggtggacaatggagatggcacacacacagtaacctataccccatctcaggaggga
ccttacatggtctcagttaaatatgctgatgaagagattcctcgcagtcccttcaaggtc
aaggtccttcccacatatgacgccagcaaagtgaccgccagtggccccggccttagttcc
tatggtgtgcctgccagtctacctgtggactttgcaattgatgcccgagatgccggggaa
ggcctgcttgctgttcaaataacggaccaagaaggaaaacccaaaagagccattgtccat
gacaataaagatggcacgtatgctgtcacctacatccccgacaagactggacgctatatg
attggggtcacctatgggggtgacaacattccactttctccttatcgcatccgagccaca
cagacgggtgatgccagcaagtgcctggccacgggtcctggaatcgcctccactgtgaaa
actagcgaagaagtaggctttgtggttgatgccaagactgccgggaaggggaaagtgacc
tgcacggttctgaccccagatggcactgaggccgaggccgatgtcattgagaatgaagat
ggaacctatgacatcttctacacagctgccaaaccgggcacatatgtgatctatgtgcgc
ttcggtggtgttgatattcctaacagccccttcactgtcatggccacagatggggaagtc
acagccgtggaggaggcaccggtaaatgcatgtccccctggattcaggccctgggtgacc
gaagaggcctatgtcccagtgagtgatatgaacggcctgggatttaagccttttgacctg
gtcattccgtttgctgtcaggaaaggagaaatcaccggagaggtccacatgccttctggg
aagacagccacacctgagattgtggacaacaaggacggcacggtcactgttagatacgcc
cccactgaggtcgggctccatgagatgcacatcaaatacatgggcagccacatccctgag
agcccactccagttctacgtgaattaccccaacagtggaagcgtttctgcatacggtcca
ggcctcgtgtatggagtggccaacaaaactgccaccttcaccatcgtcacggaggatgca
ggagaaggtggtctggacttggctattgagggcccctcaaaagcagaaatcagctgcatc
gacaacaaagatgggacatgcacagtgacctacctgcccactctgccaggcgactacagc
attctggtcaagtacaatgacaagcacatccctggcagccccttcacagccaagatcaca
gatgacagcaggcggtgctcccaggtgaagttgggctcggccgctgacttcctgctcgac
atcagtgagactgacctcagcagcctgacggccagcattaaggccccatctggccgagat
gagccctgtctcctgaagaggctgcccaacaaccacattggcatctccttcatcccccgg
gaagtgggtgaacacctggtcagcatcaagaaaaatggcaaccatgtggccaacagcccc
gtgtccatcatggtggtccagtccgagattggtgatgcccgccgagccaaagtctatggc
cgtggcctgtcagaaggccggactttcgagatgtctgacttcatcgtggacacaagggat
gcaggttatggtggcatatccttggcggtggaaggccccagcaaagtggacatccagact
gaagacctggaagatggcacctgcaaagtctcctacttccccaccgtgcctggggtttat
attgtctccaccaaattcgctgacgagcacgtgcctgggagcccatttaccgtgaagatc
agcggggagggaagagtcaaagagagcatcacccgcaccagtcgggccccgtctgtggcc
actgtcgggagcatctgtgacctgaacctgaaaatcccagaaatcaacagcagtgatatg
tcggcccatgtcaccagcccctctggccgtgtgactgaggcagagattgtgcccatgggg
aagaactcgcactgcgtccggtttgtgccccaggagatgggcgtgcacacggtcagcgtc
aagtaccgtgggcagcacgtcaccggcagccccttccagttcaccgtggggccacttggt
gaaggaggcgcccacaaggtgcgggcaggaggccctggcctggagagaggagaagcggga
gtcccagctgagttcagcatttggacccgggaagcaggcgctggaggcctctccatcgct
gttgagggccccagtaaggccgagattacatttgatgaccataaaaatgggtcatgcggt
gtgtcttatattgcccaagagcctggtaactacgaggtgtccatcaaattcaatgatgag
catatcccggaaagcccctacctggtgccggtcatcgcgccctccgacgacgcccgccgc
ctcactgttatgagccttcaggaatcgggattaaaagttaaccagccagcatcctttgct
ataaggttgaatggcgcaaaaggcaagattgatgcaaaggtgcacagcccctctggagcc
gtggaggagtgccacgtgtctgagctggagccagataagtatgctgttcgcttcattcct
catgagaatggtgtccacaccatcgatgtcaagttcaatgggagccacgtggttggaagc
cccttcaaagtgcgcgttggggagcctggacaagcgggcaaccctgccctggtgtccgcc
tatggcacgggactcgaagggggcatcacaggtatccagtcggaattctttattaacacc
acccgagcaggtccagggacattatccgtcaccatcgaaggcccgtccaaggttaaaatg
gattgtcaggaaacacctgaaggatacaaagtcatgtacacccccatggctcctggtaac
tacctgatcagtgtcaaatacggtgggcccaaccacatcgcgggcagtcccttcaaggcc
aaggtgacaggtaacgatcaaccatcttcggagttactctcccttcctggggagctggga
gaggtgagattccagtccaaggttacccaggtagcaagtggcagggcagggattcgaacc
cacaccgtcagggtctacgagcctctgcttgtaattgccacactctcccacctctcaggg
gccccagcattattgcggaagcaccttacctttggctctcatactccctccttttcctgt
gcctgtcctgacacatccggatggagtaaccacttcttttgcctcctaggctccaacatg
ctgctgatcggggtccatgggcccaccaccccctgtgaggaggtctccatgaagcatgta
ggcaaccagcaatacaacgtcacatatgtcgtcaaggagaggggcgattatgtgctggct
gtgaagtggggggaggaacacatccctggcagcccttttcatgtcacagtgccttaa

DBGET integrated database retrieval system