KEGG   Pongo abelii (Sumatran orangutan): 100437064Help
Entry
100437064         CDS       T01416                                 

Gene name
EEA1
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Endocytosis
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100437064 (EEA1)
   04145 Phagosome
    100437064 (EEA1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100437064 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 1326 aa AA seqDB search
MLVLVAVSGSGVEKEQRQDGGCEMCKLQMAFYSERSIRADDVALLRQEVQDLQASLKEEK
WYSEELKKELEKYQGLQQQEAKPDGLVTDSSAELQSLEQQLEEAQTENFNIKQMKDLFEQ
KAAQLATEILQRPGIEDVAVLKKELVQVQTLMDNMTLERERESEKLKDECKKLQSQYASS
EATISQLRSELAKGPQEVAVYVQELQKLKSSVNELTEKNQSLTENLLKKEQDYTKLEEKH
NEESVSKKNIQATLHQKDLDCQQLQSRLSASETSLHRIHAELSEKGEATQKLKEELSEVE
TKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHSKLLETERQLGEAHGRLKEQRQLSS
EKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQHQEQQALQQSTTAKLR
EAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGETAVLNQ
LQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHLRAAQDRVLSLETSVNE
LNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELNK
ITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKYLSLEQKTEELEGQIKKLEADSLEVKAS
KEQALQDLQQQRQLNTDLELRATELSKQLEMEKEIVSGTRLDLQKKSEALENIKQKLTKQ
EEEKKILKQEFETLSQEAKIQHEELNNRIQTTVTELQKVKMEKEALMTELSTVKDKLSQV
SDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQMENTLKGQKELKKSLEKEKEA
SHQLKLELNSMQEQLIQAQNTLKQKEKEEQQLQGNINELKQSSEQKKKQIEALQGELKIA
VLQKTELENKLQQQLTQAAQELAAEKEKISVLQNNYEKSQETFKQLQSDFYGRESELLAT
RQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQELQERYKAL
QDIQKEKSLKEKELVNEKSKLAEIEEIKCRQEKEITKLNEELKSHKLESIKEITNLKDAK
QLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEK
EVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATV
QNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQAL
NRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDAC
FNDLQG
NT seq 3981 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgttggtggcagtgagtggaagtggtgttgagaaggagcagcggcaagacggt
ggctgcgaaatgtgcaagttgcagatggcattctactcagagcgcagtatcagggcagat
gatgtagcactgctcagacaagaggtccaagacctacaggcttcacttaaggaagaaaaa
tggtactcggaagaattaaagaaggaattagaaaaatatcaagggctgcagcagcaagag
gccaaacctgatgggttggtgactgattcatcagcagaactacagtctttggaacagcaa
ttagaagaagcccaaacagaaaattttaatattaagcaaatgaaagacttatttgaacag
aaagcagcccaacttgctactgaaattcttcagagacctggtatagaagatgttgctgtg
ctaaagaaagaactggtccaagttcaaacactaatggataacatgaccttggaacgtgaa
cgagaatctgaaaaactcaaagatgaatgcaaaaaattgcagtcacaatatgctagctca
gaggccacaataagccagctaaggagtgaacttgccaaaggcccccaggaagttgctgta
tatgtacaggaactacaaaaactgaaaagttcagttaatgaattaacagaaaaaaatcag
tccttgacagaaaacttgctgaaaaaagaacaagactatactaagttagaggagaaacat
aatgaagaatctgtgagtaaaaagaatattcaggcaacccttcatcaaaaagacctagat
tgtcaacagcttcagtcaagattgtctgcatctgaaacctcactgcatagaatacatgca
gaactaagtgaaaaaggagaagctactcaaaagctcaaagaagaattatctgaggtagag
accaagtaccagcatctaaaggcggagtttaagcagctacaacaacagagagaagaaaag
gagcagcatgggttacaactccaaagtgaaattaatcaattacatagcaaacttctggag
acagagcgccaactaggggaagctcatggtaggctgaaggaacagagacagctttcaagt
gaaaagttgatggataaagaacagcaagtggctgatttacaactcaaactttctcggttg
gaagagcagttgaaggaaaaagttacaaattctacagaattgcagcatcaattagataaa
acaaagcaacagcatcaagaacaacaggctcttcagcagagcaccacagcaaaacttcga
gaagctcagaatgatttggaacaagttctacgtcaaattggcgataaggaccaaaagatc
cagaaccttgaagctttattacagaagagtaaagaaaatatttcattactagaaaaagaa
agagaagatctttatgcaaaaattcaggctggcgaaggagagactgctgttcttaaccag
ttacaagaaaaaaaccatacactacaggaacaagtaactcaactaacagagaagctgaag
aatcagtcggaaagccataaacaagcccaggagaatttgcatgaccaggtacaagagcag
aaggcacatcttagagctgcacaagaccgtgtcctttccctagaaactagtgtcaatgaa
ttaaatagtcaattaaatgaaagtaaggagaaggtctcccagcttgacatacagattaaa
gccaaaaccgaactattgctatcagcagaagcagcaaaaactgctcaaagagctgatctt
cagaatcatttggacacagctcaaaatgcattacaagataaacagcaggagttaaataag
attactactcagttggatcaggtcactgcaaagttacaagacaagcaagaacattgcagt
cagctggaaagtcatcttaaagaatataaagagaaatacctctctttagaacagaaaacc
gaagagctagaaggtcaaattaagaaactagaagctgatagtctcgaagttaaagcaagc
aaggagcaggctttgcaagatctacagcagcaaagacagctgaacacagatttagagctc
agagccacagaattgagtaaacaacttgaaatggagaaagaaatagtatccggtacaaga
ttggatctacagaaaaaatctgaagcccttgaaaatatcaagcaaaagcttaccaagcaa
gaggaagaaaaaaaaatcctgaaacaagaatttgaaactttaagtcaagaagcaaagatt
cagcacgaggaattgaataacagaattcaaacaacagtaacagaactacaaaaagtgaaa
atggagaaagaagctttaatgacagagctttctacagtaaaggacaaactatcacaagtt
tctgattctttgaaaaactccaaaagtgaatttgaaaaggagaatcagaaaggaaaagcc
gctatattagacttggagaaaacttgcaaagaattaaagcatcaacttcaagtgcagatg
gaaaacacacttaagggacagaaggaactgaaaaagtcacttgaaaaagagaaggaggct
tctcatcagttgaaattggaactcaattcaatgcaggaacaacttatacaggcccagaat
actttaaaacaaaaggaaaaagaagagcaacaacttcaggggaacataaatgagctaaag
caatcaagtgaacagaagaaaaaacaaattgaagcactccaaggagagcttaaaattgct
gttttacagaagacagagcttgagaataaactacagcagcagttaacacaggcagcccag
gaacttgcagcagagaaagagaaaatatcagtattacaaaacaactatgaaaaaagtcag
gaaactttcaaacagcttcaatctgatttctatgggagggaatctgaacttctagccacc
aggcaagatcttaagtctgtagaagagaagctttctctagcacaggaggacttgatttca
aacagaaatcaaattggaaatcaaaataaattgattcaagaactgaagactgccaaggct
acattggagcaggattcagcaaagaaagaacaggaattgcaggagcgatataaagcgcta
caagacattcagaaagaaaagtcactgaaagaaaaagaactagtcaatgaaaagtctaaa
ttggcagagatagaagaaattaaatgtagacaagaaaaagaaatcactaaactaaacgaa
gaactcaagtcccacaaactagaaagcataaaggagataacaaatcttaaggatgctaaa
cagcttctaattcagcagaaattagaacttcaaggaaaagcggactccttgaaagcagct
gtggaacaggagaagagaaatcagcagatactaaaagaccaggtgaaaaaggaagaagag
gagctgaagaaagaatttattgagaaagaagctaagttgcattccgaaataaaagaaaag
gaagtaggaatgaagaagcatgaagaaaatgaggctaaacttaccatgcagattacagca
ttaaatgaaaacttaggcactgtgaagaaggagtggcaatctagtcaacggagagttagt
gagctcgagaaacaaacggatgacttacggggtgaaattgcagtattagaagcaacggtt
cagaataatcaagatgaaaggagagcactactggaaagatgtcttaaaggagaaggtgaa
atagaaaagcttcaaaccaaagtattagaactgcaaagaaagctggataatacaactgca
gcagtgcaggagctgggcagagaaaaccagtcacttcagatcaaacatacacaagcgttg
aatagaaagtgggccgaagacaatgaagtacaaaactgtatggcctgtgggaaaggcttt
tcagtaacagtgagacggcatcactgccgacagtgtggaaatatcttctgtgctgaatgt
tcagccaaaaatgccttaactccttcctccaagaagcctgttcgtgtctgtgatgcatgt
ttcaatgacttgcaaggataa

DBGET integrated database retrieval system