KEGG   Pongo abelii (Sumatran orangutan): 100437095Help
Entry
100437095         CDS       T01416                                 

Gene name
ALPPL2
Definition
alkaline phosphatase, placental-like 2
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100437095 (ALPPL2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100437095 (ALPPL2)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100437095 (ALPPL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 532 aa AA seqDB search
MQGPWVLLLLGLRLQLSLGVIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLILFLG
DGMGVSTVTAARILKGQKKGKLGPETFLAMDRFPYVALSKTYSVDKHVPDSAATATAYLC
GVKGNFETIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDS
RQKGTRLDGKNLVQEWLAKHQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALHLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERA
GQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESESPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFVAHV
MAFAACLEPYTACDLAPHAGITDAAHPGPSVVPALLSLLAGTLLLLGTATAP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggccctgggtgctgctcctgctgggcctgaggctacaactctccctgggcgtc
atcccagttgaggaggagaacccggacttctggaaccgccaggcagccgaggccctgggt
gccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcctcttcctgggc
gacgggatgggggtgtctacggtgacagctgccaggatcctaaaagggcagaagaagggc
aaactggggcctgagaccttcctggccatggaccgcttcccatacgtggctctgtccaag
acatacagtgtagacaagcatgtgccagacagcgcagccacagccacggcctacctgtgc
ggggtcaagggcaacttcgagaccatcggcttgagtgcagccgcccgctttaaccagtgc
aacacgacacgcggcaacgaggtcatctccgtgatgaatcgggccaagaaagcaggaaag
tcagtgggagtggtgaccaccacacgggtgcagcacgcctcgccagccggtgcctacgcc
cacacggtgaaccgcaactggtactcggacgccgacgtgcctgcctcagcccgccaggag
gggtgccaggacatcgccacgcagctcatctccaacatggacattgatgtgatcctaggt
ggaggccgaaagtacatgtttcccatggggaccccagaccctgagtacccagatgactcc
aggcagaaagggaccaggctggacgggaagaatctggtgcaggaatggctggcaaagcac
cagggtgcccggtacgtgtggaaccgcactgagctcatgcaggcgtccctggacccgtct
gtgacccatctcatgggtctctttgagcccggagacatgaaatacgagatccaccgagac
tccacactggacccctccctgatggagatgacggaggctgccctgcatttgctgagcagg
aacccccgcggcttcttcctcttcgtggagggcggtcgcatcgaccatggccatcatgaa
agcagggcttaccgggcactgactgagacgatcatgttcgacgacgccattgagagggcg
ggccagctcaccagcgaggaggacacgctgagcctcgtcactgctgaccactcccacgtc
ttctccttcggaggctaccccctgcgagggagctccatcttcgggctggcccctggcaag
gcccgggacaggaaggcctacacggtcctcctctacggaaacggtccgggctatgtgctc
aaggacggcgcccggccggatgttaccgagagcgagagcgagagccccgagtatcggcag
cagtcagcagtgcccctggatggagagacccacgcaggcgaggacgtggcggtgttcgcg
cgcggcccgcaggcgcacctggttcacggcgtgcaggagcagacctttgtagcgcacgtc
atggccttcgccgcctgcctggagccctacacggcctgcgacctggcgccccacgccggc
atcaccgacgccgcgcacccggggccgtccgtggtacccgcgttgctttctctgctggcc
gggaccctgctgctgctggggacggccactgctccctga

DBGET integrated database retrieval system