KEGG   Pongo abelii (Sumatran orangutan): 100437341Help
Entry
100437341         CDS       T01416                                 

Gene name
NLK
Definition
nemo-like kinase
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100437341 (NLK)
   04310 Wnt signaling pathway
    100437341 (NLK)
   04068 FoxO signaling pathway
    100437341 (NLK)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    100437341 (NLK)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100437341 (NLK)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100437341 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 527 aa AA seqDB search
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHGAPVLQRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcgcaagagccaacgcaaaaatgatggcggcttacaatggcggtaca
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttccacacctccctcct
cctcacctgcaccaccaccaccaccctcaacaccatcttcatccggggtcggctgccgct
gtacaccctgtacagcagcacacctcttcggcagctgcggcagccgcagcagcggctgca
gctgcagccatgttaaaccctgggcaacaacagccatatttcccatcaccggcaccgggg
caggctcctggaccagctgcagcagccccagctcaggtacaggctgccgcagctgctaca
gttaaggcgcaccatcatcagcactcgcatcatccacaacagcagctggatattgagcca
gatagacctattggatatggagcctttggtgttgtctggtcagtaacagatccgagagat
ggaaagagagtagcgctcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agggtcttccgggaattgaagatgttgtgtttttttaagcatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagaaatatacgttgtcacagaa
ttgatgcagagtgacctacataaaattatcgtctctcctcaaccactcagctcagatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccatggagccccggtt
ttacagcgagacattaagccagggaatctccttgtgaacagcaactgtgttctaaagatt
tgtgattttggattggccagagtggaagaattagatgaatcccgtcatatgactcaggaa
gttgttactcagtattatcgggctccagaaatcctgatgggcagccgtcattacagcaat
gctattgacatctggtctgtgggatgtatctttgcagaactactaggacgaagaatattg
tttcaggcacagagtcccattcagcagttggatttgatcacggatctgttgggcacacca
tcactggaagcaatgaggacagcttgtgaaggcgctaaggcacatatactcaggggtcct
cataaacagccatctcttcctgtactctataccctgtctagccaggctacacatgaagct
gttcatctcctttgcaggatgttggtctttgatccatccaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcgactacgatatcacacatgtatgtgtaaa
tgttgcttttccacctctactggaagagtttataccagtgactttgagcctgtcaccaat
cccaaatttgatgacacttttgagaagaacctcagttctgtccgacaggttaaagaaatt
attcatcagttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaaccct
cagtctgctgcttttaagagctttattagttccactgttgctcagccatctgagatgccc
ccatctcctctggtgtgggagtga

DBGET integrated database retrieval system