KEGG   Pongo abelii (Sumatran orangutan): 100437391Help
Entry
100437391         CDS       T01416                                 

Definition
cytochrome P450 3A43-like
Orthology
K17692  
cytochrome P450, family 3, subfamily A, polypeptide 43 [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100437391
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100437391
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP3 family
   100437391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 503 aa AA seqDB search
MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWKF
DRECNEKYGEMWGLYEGQQPMLVIMDPNMIKTVLVKECYSVFTNRMPLGPMGFLKSALSF
AEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYT
MDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLLISLFPFLTPVFEALNIGL
FPKDVTRFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSI
IITFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVV
NETLRLFPVVSRVTTVCKKDIEINGVLIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFS
KKNKDSIDPYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNL
PILQPEKPIVLKVHLRDGITSGP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcattccaaactttgccatggaaacatgggttctcgtggctaccagcctggta
ctcctctatatctatgggacccattcacataaactttttaagaagctgggaattcctggg
ccaacccctctgccttttctgggaactattttgttctaccttaggggtctttggaaattt
gacagagaatgtaatgaaaaatatggagaaatgtgggggctgtatgaggggcaacagccc
atgctggtcatcatggatcccaacatgatcaaaacagtgctagtgaaagaatgttactct
gtcttcacaaaccggatgcctttaggtccaatgggatttctgaaaagtgccttaagtttt
gctgaagatgaagaatggaagagaatacgaacattgctatctccagctttcaccagtgta
aaattcaaggaaatggtccccatcatttcccagtgtggagatatgttggtgagaagcctg
aggcaggaagcagagaacagcaagtccatcaacttgaaagatttctttggggcctacacc
atggatgtaatcactggcacattatttggagtgaacttggattctctcaacaacccacaa
gatccctttctgaaaaatatgaagaagcttttaaaattggattttttggatcccttttta
ctcttaatatcactctttccatttcttaccccagtttttgaagccctaaatatcggtttg
tttccaaaagatgttacccgttttttaaaaaattccattgaaaggatgaaagaaagtcgc
ctcaaagataaacaaaagcaccgagtagatttcttccaacagatgattgactcccagaat
tccaaagaaacaaagtcccataaagctctgtctgatctggagcttgtggcccagtcaatt
atcatcacttttgctgcctatgacacaactagcaccactctccccttcattatgtatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggagattgacgcagttttaccc
aataaggcacctgtcacctatgatgccctggtacagatggaataccttgacatggtggtg
aatgaaacgctcagattattcccagttgttagtagagttacgacagtctgcaagaaagat
attgaaatcaatggagtcttaattcccaaagggttagcagtgatggttccaatctatgct
cttcaccatgacccaaagtactggacagagcctgagaagttctgccctgaaaggttcagt
aagaagaacaaggacagcatagatccttacagatacataccttttggagctggaccccga
aactgcattggcatgaggtttgctctcacaaacataaaacttgctgtcattagagcactg
cagaacttctccttcaaaccttgtaaagagacgcagatcccactgaaattagacaatcta
ccaattcttcaaccagaaaaacctattgttctaaaagtgcacttaagagatgggattaca
agtggaccctga

DBGET integrated database retrieval system