KEGG   Pongo abelii (Sumatran orangutan): 100437424Help
Entry
100437424         CDS       T01416                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04024  cAMP signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04137  Mitophagy - animal
pon04140  Autophagy - animal
pon04141  Protein processing in endoplasmic reticulum
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04217  Necroptosis
pon04310  Wnt signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04530  Tight junction
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04723  Retrograde endocannabinoid signaling
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04910  Insulin signaling pathway
pon04912  GnRH signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04917  Prolactin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04926  Relaxin signaling pathway
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease (NAFLD)
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05132  Salmonella infection
pon05133  Pertussis
pon05142  Chagas disease (American trypanosomiasis)
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05164  Influenza A
pon05167  Kaposi's sarcoma-associated herpesvirus infection
pon05168  Herpes simplex infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05231  Choline metabolism in cancer
pon05418  Fluid shear stress and atherosclerosis
Module
pon_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100437424 (MAPK8)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100437424 (MAPK8)
   04010 MAPK signaling pathway
    100437424 (MAPK8)
   04012 ErbB signaling pathway
    100437424 (MAPK8)
   04310 Wnt signaling pathway
    100437424 (MAPK8)
   04668 TNF signaling pathway
    100437424 (MAPK8)
   04068 FoxO signaling pathway
    100437424 (MAPK8)
   04071 Sphingolipid signaling pathway
    100437424 (MAPK8)
   04024 cAMP signaling pathway
    100437424 (MAPK8)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100437424 (MAPK8)
   04137 Mitophagy - animal
    100437424 (MAPK8)
  Cell growth and death
   04210 Apoptosis
    100437424 (MAPK8)
   04215 Apoptosis - multiple species
    100437424 (MAPK8)
   04217 Necroptosis
    100437424 (MAPK8)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100437424 (MAPK8)
   04530 Tight junction
    100437424 (MAPK8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100437424 (MAPK8)
   04621 NOD-like receptor signaling pathway
    100437424 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    100437424 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    100437424 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    100437424 (MAPK8)
   04659 Th17 cell differentiation
    100437424 (MAPK8)
   04657 IL-17 signaling pathway
    100437424 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    100437424 (MAPK8)
  Endocrine system
   04910 Insulin signaling pathway
    100437424 (MAPK8)
   04920 Adipocytokine signaling pathway
    100437424 (MAPK8)
   04912 GnRH signaling pathway
    100437424 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    100437424 (MAPK8)
   04917 Prolactin signaling pathway
    100437424 (MAPK8)
   04926 Relaxin signaling pathway
    100437424 (MAPK8)
  Nervous system
   04728 Dopaminergic synapse
    100437424 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    100437424 (MAPK8)
   04722 Neurotrophin signaling pathway
    100437424 (MAPK8)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100437424 (MAPK8)
  Development
   04380 Osteoclast differentiation
    100437424 (MAPK8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100437424 (MAPK8)
   05231 Choline metabolism in cancer
    100437424 (MAPK8)
   05210 Colorectal cancer
    100437424 (MAPK8)
   05212 Pancreatic cancer
    100437424 (MAPK8)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100437424 (MAPK8)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100437424 (MAPK8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100437424 (MAPK8)
   04931 Insulin resistance
    100437424 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100437424 (MAPK8)
  Infectious diseases
   05132 Salmonella infection
    100437424 (MAPK8)
   05133 Pertussis
    100437424 (MAPK8)
   05152 Tuberculosis
    100437424 (MAPK8)
   05164 Influenza A
    100437424 (MAPK8)
   05161 Hepatitis B
    100437424 (MAPK8)
   05160 Hepatitis C
    100437424 (MAPK8)
   05168 Herpes simplex infection
    100437424 (MAPK8)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100437424 (MAPK8)
   05169 Epstein-Barr virus infection
    100437424 (MAPK8)
   05145 Toxoplasmosis
    100437424 (MAPK8)
   05142 Chagas disease (American trypanosomiasis)
    100437424 (MAPK8)
  Drug resistance
   01522 Endocrine resistance
    100437424 (MAPK8)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100437424 (MAPK8)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100437424 (MAPK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 DUF530
Motif
Other DBs
NCBI-GeneID: 100437424
NCBI-ProteinID: XP_002820749
Ensembl: ENSPPYG00000002246
UniProt: A0A2J8RSY1
Position
10
AA seq 427 aa AA seqDB search
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattctcgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcattctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgactgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt
atgatgacgccttacgtagtgactcgctactacagagcacccgaggtcatcctcggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtccttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtcc
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
gggcctctgggctgctgtagatga

DBGET integrated database retrieval system