KEGG   Pongo abelii (Sumatran orangutan): 100437449Help
Entry
100437449         CDS       T01416                                 

Gene name
ABL2
Definition
(RefSeq) ABL proto-oncogene 2, non-receptor tyrosine kinase
  KO
K08887  
abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
ErbB signaling pathway
Ras signaling pathway
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100437449 (ABL2)
   04012 ErbB signaling pathway
    100437449 (ABL2)
 Human Diseases
  Cardiovascular diseases
   05416 Viral myocarditis
    100437449 (ABL2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100437449 (ABL2)
Protein kinases [BR:pon01001]
 Tyrosine protein kinases
  Abl family
   100437449 (ABL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1161 aa AA seqDB search
MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHEALHRPYG
CDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQ
NGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESE
SSPGQLSISLRYEGRVYHYRINTTTDGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHY
PAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKE
DTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEV
TAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTA
HAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKG
YRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAAS
SSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSP
ALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHK
KYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGGSFAQRNLCNDDGGGGGGSGTA
GGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTL
PRNCQRSKLHLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGAAALP
LRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLGMAGVPEDGEQPGWPSPAKAAP
VLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPK
CAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKAGRPVM
PPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKISADKISKEALLECADLLSSAIT
EPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPG
TNPVLNNLLSCVQEISDVVQR
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcaggtgggccgcgtcggggaagctccggggctccagcagcctcagccccgc
gggatccggggcagcagtgcagccaggccctccggccgcaggcgggacccggcggggcgc
accacagagactggcttcaatatcttcacccagcatgaagctttgcatcgtccctatggt
tgtgatgttgaaccccaggcactaaatgaggctatcaggtggagctccaaggagaacttg
ctcggagccaccgagagtgaccctaatctcttcgttgcactttatgattttgtagcaagt
ggtgataacacactcagcatcactaaaggtgaaaagctacgagtccttggttacaaccag
aatggcgagtggagtgaagttcgctctaagaacgggcagggctgggtgccaagcaactac
atcaccccagtgaacagtctggaaaaacactcctggtaccatggacctgtgtcacgcagt
gcagctgagtatctgctcagcagtctaatcaatggcagcttcctggtacgagaaagtgag
agtagccctgggcagctgtccatctcgctcaggtacgagggacgtgtgtatcactacagg
atcaataccaccacagatggcaaggtgtatgtgactgctgagagccgcttcagcaccttg
gcagagcttgtacaccatcactccacagtggctgatgggctggtgacaacattacactac
ccagcacccaagtgtaataagcctacagtctatggtgtgtcccccatccacgacaaatgg
gaaatggagcgaacagatattaccatgaagcacaaacttgggggcggtcagtatggagag
gtttacgttggcgtctggaagaaatacagccttacagttgctgtgaaaacattgaaggaa
gataccatggaggtagaagaattcctgaaagaagctgcggtaatgaaggaaatcaagcat
cctaatctggtacaacttttaggtgtgtgtactttggagccaccattttacattgtgact
gaatacatgccatacgggaatttgctggattacctccgagaatgcaaccgagaagaggtg
actgcagttgtgctgctctacatggccactcagatttcttctgcaatggagtacttagag
aagaagaatttcatccatagagatcttgcagctcgtaactgcctagtgggagaaaaccat
gtggtaaaagtggctgactttggcttaagtagattgatgactggagacacttatactgct
catgctggagccaaatttcctattaagtggacagcaccagagagtcttgcctacaatacc
ttctcaattaaatctgacgtctgggcttttggggtactgttgtgggaaatcgctacctat
ggaatgtcaccatatccaggtattgacctgtctcaggtctacgacctcctagaaaaagga
tatcgaatggaacagcctgagggatgcccccctaaggtttatgaacttatgagagcatgc
tggaagtggagccctgccgataggccctcttttgctgaaacacaccaagcttttgaaacc
atgttccatgactccagcatttctgaagaggtagctgaggagcttgggagagctgcctcc
tcatcatctgttgttccatacctgccccggctacctatacttccttccaagactcggaca
ctgaagaaacaggtggagaacaaggagaacattgaaggggcacaagatgccacagaaaat
tctgcttccagtttagcaccagggttcatcagaggtgcgcaggcctccagtggatcccca
gcactgcctcgaaagcaaagagacaagtcacccagcagcctcttggaagatgccaaagag
acatgcttcaccagggataggaaggggggcttcttcagctccttcatgaaaaagagaaat
gctcctacaccccctaaacgcagcagctccttccgagaaatggagaatcagccccataag
aaatacgaactcacgggtaacttctcatctgttgcttctctacagcatgctgatgggttc
tctttcactcctgcccagcaagaggcgaatctggtgccacccaagtgctatggggggagc
tttgcacagaggaacctctgtaatgacgacggtggtgggggtgggggcagtggcactgct
gggggtgggtggtctggcatcacaggcttctttacaccacgcttaatcaaaaagacactg
ggcttacgagcaggtaaacccacagccagtgatgacacttccaagccttttccaaggtca
aactctacatcttccatgtcctcagggcttccagagcaggataggatggcaatgaccctt
cccaggaactgccagaggtccaaactccacctggaaaggacagtgtccacctcttctcag
ccagaagagaatgtggacagggccaatgacatgcttccaaaaaaatcagaggaaagtgct
gctccaagcagggagagaccaaaagccaagttattgcccagaggagccgcagctcttcct
ctcagaacaccctctggggatctagccattacagagaaggaccctccaggggtgggagtg
gctggagtggcagctgcccccaagggcaaagagaagaatggtggggcacgacttgggatg
gctggagttccagaggatggagagcagccgggctggccttctccagccaaggctgcccct
gtcctcccaaccactcacaaccacaaagtgccagtccttatctcacccaccctgaaacac
actccagctgatgtgcagctcattggcacagactctcaggggaataaattcaagctctta
tctgagcatcaggtcacatcctctggagacaaggaccgaccccgacgggtaaaaccaaag
tgtgccccacccccaccaccagtgatgagactactgcagcatccgtccatctgctcagac
cctacagaagagccgactgccctaactgcaggacagtccacgtcagaaacacaggaagga
ggaaagaaggcagctctgggcgcagtgcccatcagtgggaaagctgggaggccagtgatg
cctccacctcaagtgcctctgcccacatcttccatctcgccagccaaaatggccaacggc
acagcaggtactaaagtggctctgagaaaaaccaaacaggccgctgagaaaatctcagca
gacaaaatcagcaaagaggccctgctggaatgtgctgacctactgtccagtgcaatcacg
gaacctgtgcccaacagccagctggtagacactggacaccagctgcttgactactgctca
ggctatgtggactgcatccctcaaactcgcaacaaatttgccttccgagaggctgtgagc
aaactggaactcagcctgcaggagctacaggtttcttcagcagctgctggtgtgcccggg
acaaaccctgtccttaataacttattgtcatgtgtacaggaaatcagtgatgtggtgcag
aggtag

DBGET integrated database retrieval system