KEGG   Pongo abelii (Sumatran orangutan): 100437449Help
Entry
100437449         CDS       T01416                                 

Gene name
ABL2
Definition
v-abl Abelson murine leukemia viral oncogene homolog 2
Orthology
K08887  
abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
ErbB signaling pathway
Ras signaling pathway
Viral myocarditis
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:pon04014]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:pon04012]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:pon05416]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1182 aa AA seqDB search
MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHDHFASCVE
DGFEGDKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTTDGKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIV
TEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
NSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKR
NAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGG
SFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPR
SNSTSSMSSGLPEQDRMAMTLPRNCQRSKLHLERTVSTSSQPEENVDRANDMLPKKSEES
AAPSRERPKAKLLPRGAAALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLG
MAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKL
LSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQE
GGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKIS
ADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAV
SKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcaggtgggccgcgtcggggaagctccggggctccagcagcctcagccccgc
gggatccggggcagcagtgcagccaggccctccggccgcaggcgggacccggcggggcgc
accacagagactggcttcaatatcttcacccagcatgatcactttgccagctgtgtggag
gatggatttgagggagacaagactggaggcagtagtccagaagctttgcatcgtccctat
ggttgtgatgttgaaccccaggcactaaatgaggctatcaggtggagctccaaggagaac
ttgctcggagccaccgagagtgaccctaatctcttcgttgcactttatgattttgtagca
agtggtgataacacactcagcatcactaaaggtgaaaagctacgagtccttggttacaac
cagaatggcgagtggagtgaagttcgctctaagaacgggcagggctgggtgccaagcaac
tacatcaccccagtgaacagtctggaaaaacactcctggtaccatggacctgtgtcacgc
agtgcagctgagtatctgctcagcagtctaatcaatggcagcttcctggtacgagaaagt
gagagtagccctgggcagctgtccatctcgctcaggtacgagggacgtgtgtatcactac
aggatcaataccaccacagatggcaaggtgtatgtgactgctgagagccgcttcagcacc
ttggcagagcttgtacaccatcactccacagtggctgatgggctggtgacaacattacac
tacccagcacccaagtgtaataagcctacagtctatggtgtgtcccccatccacgacaaa
tgggaaatggagcgaacagatattaccatgaagcacaaacttgggggcggtcagtatgga
gaggtttacgttggcgtctggaagaaatacagccttacagttgctgtgaaaacattgaag
gaagataccatggaggtagaagaattcctgaaagaagctgcggtaatgaaggaaatcaag
catcctaatctggtacaacttttaggtgtgtgtactttggagccaccattttacattgtg
actgaatacatgccatacgggaatttgctggattacctccgagaatgcaaccgagaagag
gtgactgcagttgtgctgctctacatggccactcagatttcttctgcaatggagtactta
gagaagaagaatttcatccatagagatcttgcagctcgtaactgcctagtgggagaaaac
catgtggtaaaagtggctgactttggcttaagtagattgatgactggagacacttatact
gctcatgctggagccaaatttcctattaagtggacagcaccagagagtcttgcctacaat
accttctcaattaaatctgacgtctgggcttttggggtactgttgtgggaaatcgctacc
tatggaatgtcaccatatccaggtattgacctgtctcaggtctacgacctcctagaaaaa
ggatatcgaatggaacagcctgagggatgcccccctaaggtttatgaacttatgagagca
tgctggaagtggagccctgccgataggccctcttttgctgaaacacaccaagcttttgaa
accatgttccatgactccagcatttctgaagaggtagctgaggagcttgggagagctgcc
tcctcatcatctgttgttccatacctgccccggctacctatacttccttccaagactcgg
acactgaagaaacaggtggagaacaaggagaacattgaaggggcacaagatgccacagaa
aattctgcttccagtttagcaccagggttcatcagaggtgcgcaggcctccagtggatcc
ccagcactgcctcgaaagcaaagagacaagtcacccagcagcctcttggaagatgccaaa
gagacatgcttcaccagggataggaaggggggcttcttcagctccttcatgaaaaagaga
aatgctcctacaccccctaaacgcagcagctccttccgagaaatggagaatcagccccat
aagaaatacgaactcacgggtaacttctcatctgttgcttctctacagcatgctgatggg
ttctctttcactcctgcccagcaagaggcgaatctggtgccacccaagtgctatgggggg
agctttgcacagaggaacctctgtaatgacgacggtggtgggggtgggggcagtggcact
gctgggggtgggtggtctggcatcacaggcttctttacaccacgcttaatcaaaaagaca
ctgggcttacgagcaggtaaacccacagccagtgatgacacttccaagccttttccaagg
tcaaactctacatcttccatgtcctcagggcttccagagcaggataggatggcaatgacc
cttcccaggaactgccagaggtccaaactccacctggaaaggacagtgtccacctcttct
cagccagaagagaatgtggacagggccaatgacatgcttccaaaaaaatcagaggaaagt
gctgctccaagcagggagagaccaaaagccaagttattgcccagaggagccgcagctctt
cctctcagaacaccctctggggatctagccattacagagaaggaccctccaggggtggga
gtggctggagtggcagctgcccccaagggcaaagagaagaatggtggggcacgacttggg
atggctggagttccagaggatggagagcagccgggctggccttctccagccaaggctgcc
cctgtcctcccaaccactcacaaccacaaagtgccagtccttatctcacccaccctgaaa
cacactccagctgatgtgcagctcattggcacagactctcaggggaataaattcaagctc
ttatctgagcatcaggtcacatcctctggagacaaggaccgaccccgacgggtaaaacca
aagtgtgccccacccccaccaccagtgatgagactactgcagcatccgtccatctgctca
gaccctacagaagagccgactgccctaactgcaggacagtccacgtcagaaacacaggaa
ggaggaaagaaggcagctctgggcgcagtgcccatcagtgggaaagctgggaggccagtg
atgcctccacctcaagtgcctctgcccacatcttccatctcgccagccaaaatggccaac
ggcacagcaggtactaaagtggctctgagaaaaaccaaacaggccgctgagaaaatctca
gcagacaaaatcagcaaagaggccctgctggaatgtgctgacctactgtccagtgcaatc
acggaacctgtgcccaacagccagctggtagacactggacaccagctgcttgactactgc
tcaggctatgtggactgcatccctcaaactcgcaacaaatttgccttccgagaggctgtg
agcaaactggaactcagcctgcaggagctacaggtttcttcagcagctgctggtgtgccc
gggacaaaccctgtccttaataacttattgtcatgtgtacaggaaatcagtgatgtggtg
cagaggtag

DBGET integrated database retrieval system