KEGG   Pongo abelii (Sumatran orangutan): 100437462Help
Entry
100437462         CDS       T01416                                 

Gene name
PFN4
Definition
(RefSeq) profilin-4
  KO
K05759  profilin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100437462 (PFN4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100437462 (PFN4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100437462 (PFN4)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Others
    100437462 (PFN4)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100437462 (PFN4)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100437462 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 100437462
NCBI-ProteinID: XP_009235771
Ensembl: ENSPPYG00000012601
UniProt: H2P6U0
Position
2A
AA seq 129 aa AA seqDB search
MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVMPSDVQTLVNGFAKNPLQAR
RGGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATESL
GDYLRKKGS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt
gcagccctcatcaaaatccaggagcggagcttgtgtgtagcatcaccaggtttcaatgta
atgcccagtgatgtccaaacactggtgaatggatttgccaagaaccctttgcaagcccga
agaggaggattgtatttcaagggaaaagattacagatgtgtccgggcagatgaatattct
ctttatgccaaaaatgagaacactggtgtagttgtcgtgaagacccatctgtatcttctg
gtggcaacttacactgagggcatgtatcctagtgtctgtgtggaagccacagagagcctg
ggagactacctaagaaaaaaaggaagttaa

DBGET integrated database retrieval system