KEGG   Pongo abelii (Sumatran orangutan): 100437462Help
Entry
100437462         CDS       T01416                                 

Definition
uncharacterized LOC100437462
Orthology
K05759  
profilin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100437462
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100437462
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100437462
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100437462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2A
AA seq 435 aa AA seqDB search
MDFEHEPSSFPNKRPSPQTPDDGFRASLLYKQARCSLKESPVPWNEFPRPPPSGGNCNFL
ATETQAELLREGREGLSVTLRESSSSARLEVLPEARVRRGCRRRPHPLSPITPTPGPSSH
PLGRAPAASTPVPGRGPPAQARGAWGPPGLAGRSPARQAPLCPPKASRPAAVLLHTRARP
HGPGVVRLRLKESPPASAERANVGAHCLPDAAPREPSAPCAAGSTASPRGRCRGGGGRLQ
AQRGLGGGSSWRVLVCGRGWSRCFSVTGAWPGQSCRRHPPATASVDGRVLGLRVLAGHQR
AEWRPLPRVLGAGEFTAHHPLPHLGSCSGTKPLEGSGGKGAPVPEVMPSDVQTLVNGFAK
NPLQARRGGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCV
EATESLGDYLRKKGS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaacacgaaccatccagtttccctaacaagaggccttcaccacagactcca
gatgacggcttcagagccagcctcctttataagcaggcgagatgctctttgaaagaatcc
cccgtcccttggaatgaattcccacgtccccctccaagtgggggcaactgcaactttctg
gctacagaaacacaggctgagctgcttagagaaggcagggaggggctttcggtcacactg
cgcgagtcttcgagctctgcgcggctcgaagtcctccccgaggcccgggtgcgacgggga
tgtcgtaggcgtccgcacccgctctcgcccatcacgcccactcccggcccttcctcccac
ccactaggccgggcgcctgcggcctccacgccagtcccgggccgggggcctcccgcgcag
gcgcgtggtgcgtggggaccgcccggcctggcggggaggtcgccggcgcgacaggcacct
ctctgccctcccaaggccagcaggcccgcagccgtcctgctccacactcgggcccggccc
cacggccccggagtcgtccggctgcggctgaaagagagcccgcccgcgtctgcggaacgc
gcgaatgttggcgcccactgtctcccggacgcagcgccgcgcgagccctccgccccctgc
gccgcgggttccacagcgagtccgcgcgggcggtgccggggcggcggaggacggcttcag
gcccaaaggggattgggcggcggctctagctggcgggtcttggtttgcggaaggggctgg
agtcgctgcttctcggtgaccggcgcgtggcccggccaatcctgccgccgccacccaccc
gcaaccgcgtccgttgacgggcgggtccttggtctccgggtccttgcggggcaccagaga
gcggagtggcgtccgctccctcgagtcctcggtgccggggaattcaccgctcaccacccc
ctgccccaccttgggtcctgctcggggaccaaaccactggaaggcagtggcgggaaaggg
gcgcctgtgccagaggtaatgcccagtgatgtccaaacactggtgaatggatttgccaag
aaccctttgcaagcccgaagaggaggattgtatttcaagggaaaagattacagatgtgtc
cgggcagatgaatattctctttatgccaaaaatgagaacactggtgtagttgtcgtgaag
acccatctgtatcttctggtggcaacttacactgagggcatgtatcctagtgtctgtgtg
gaagccacagagagcctgggagactacctaagaaaaaaaggaagttaa

DBGET integrated database retrieval system