KEGG   Pongo abelii (Sumatran orangutan): 100437501Help
Entry
100437501         CDS       T01416                                 

Gene name
DHFR
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pon00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pon00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 135 aa AA seqDB search
MGKKTWFSIPEKNRPLKDRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDM
VWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQE
EKGIKYKFEVYEKND
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaagacctggttctccattcctgagaagaatcgacctttaaaggatagaatt
aatttagttctcagcagagaactcaaggaacctccacaaggagctcattttctttccaga
agtctagatgatgccttaaaacttactgaacaaccagaattagcaaataaagtagacatg
gtctggatagttggtggcagttctgtttataaggaagccatgaatcacccaggccatctt
aaactatttgtgacaaggatcatgcaggactttgaaagtgacacattttttccagaaatt
gatttggagaaatataaactcctgccagaatacccaggtgttctctctgatgtccaggag
gagaaaggcattaagtacaaatttgaagtatatgagaagaatgattaa

DBGET integrated database retrieval system