KEGG   Pongo abelii (Sumatran orangutan): 100437701Help
Entry
100437701         CDS       T01416                                 

Gene name
CHP2
Definition
calcineurin-like EF hand protein 2
Orthology
K17611  
calcineurin B homologous protein 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 196 aa AA seqDB search
MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAF
QLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKS
LEKMDVEQKMSIRILK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgcgcagctcccacgccgcggtcattcccgacggggacagtattcggcgagag
accggcttctcccaagccagcctgctccgcctgcaccaccggttccgggcactggacagg
aataagaagggctacctgagccgcatggatctccagcagataggggcgctcgccgtgaac
cccctgggagaccgaattatagaaagcttcttccccgatgggagccagcgagtggatttc
ccgggctttgtcagggtcttggctcattttcgccctgtagaagatgaggacacagaaacc
caagatcccaagaaacctgaacctctcaacagcagaaggaacaaacttcactatgcattt
cagctctatgacctggatcgcgatgggaagatctccaggcatgaaatgctgcaggttctc
cgtctgatggtcggggtacaggtgacagaagagcagctggagaacatcgctgaccgcacg
gtgcaggaggctgatgaagatggggatggggctgtgtccttcgtggagttcaccaagtcc
ttagagaagatggatgttgagcaaaaaatgagcatccggatcctgaagtga

DBGET integrated database retrieval system