KEGG   Pongo abelii (Sumatran orangutan): 100437791Help
Entry
100437791         CDS       T01416                                 

Gene name
PRKG1
Definition
protein kinase, cGMP-dependent, type I
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100437791 (PRKG1)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100437791 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100437791 (PRKG1)
  Digestive system
   04970 Salivary secretion
    100437791 (PRKG1)
  Nervous system
   04730 Long-term depression
    100437791 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    100437791 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    100437791 (PRKG1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100437791 (PRKG1)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100437791 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 582 aa AA seqDB search
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMK
NLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKV
FGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSL
PEEILSKLVDVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLG
KGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRELYRTFKDSKYLYMLMEACLGGELWTI
LRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKI
GFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNI
ILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRK
GTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccttgcgggatttacagtacgcgctccaggagaagatcgaggagctgaggcag
cgggatgctctcatcgacgagctggagctggagttggatcagaaggacgaactgatccag
aagctgcagaacgagctggacaagtaccgctcggtgatccgaccagccacccagcaggcg
cagaagcagagcgcgagcaccttgcagggcgagccgcgcaccaagcggcaggcgatctcc
gccgagcccaccgccttcgacatccaggatctcagccatgtgaccctgcccttctacccc
aagagcccacagtccaaggatcttataaaggaagctatccttgataatgactttatgaag
aacttggagctgtcgcagatccaggagattgtggattgtatgtacccggtggagtatggc
aaggacagttgcatcatcaaagaaggagatgtggggtcactggtgtatgtcatggaagat
ggtaaggttgaagttacaaaagaaggtgtgaagttgtgtaccatgggtccaggaaaagtg
tttggggagttggctattctttacaactgtacccggacagcgaccgtcaagactcttgta
aatgtaaaactctgggccattgatcgacaatgttttcaaacaataatgatgaggacagga
ctcatcaagcataccgagtatatggaatttttaaaaagcgttccaacattccagagcctt
cctgaagagatcctcagcaagctcgttgatgtccttgaagagacccactatgaaaatgga
gaatatattatcaggcaaggtgcaagaggggacaccttctttatcatcagcaaaggaacg
gtaaatgtcactcgtgaagactcaccaagtgaagacccagtctttcttagaactttagga
aaaggagactggtttggagagaaagccttgcagggggaagatgtgagaacagcaaacgta
attgctgcagaagctgtaacctgccttgtgattgacagagaactgtacagaacatttaag
gacagcaaatatttgtatatgttgatggaagcttgtctaggtggagagctctggaccatt
ctcagggatagaggttcatttgaagattctacaaccagattttacacagcatgtgtggta
gaagcttttgcctatctgcattccaaaggaatcatttacagggacctcaagccagaaaat
ctcatcctagatcaccgaggttatgccaaactggttgattttggctttgcaaagaaaata
ggatttggaaagaaaacatggactttttgtggaactccagagtatgtagccccagagatc
atcctgaacaaaggccatgacatttcagccgactactggtcactgggaatcctaatgtat
gaactcttgactggcagcccacctttctcaggcccagatcctatgaaaacctataacatc
atattgagggggattgacatgatagaatttccaaagaagattgccaaaaatgctgctaat
ttaattaaaaaactatgcagggacaatccatcagaaagattagggaatttgaaaaatgga
gtaaaagacattcaaaagcacaaatggtttgagggctttaactgggaaggcttaagaaaa
ggtaccttgacacctcctataataccaagtgttgcatcacccacagacacaagtaatttt
gacagtttccctgaggacaacgatgaaccaccacctgatgacaactcaggatgggacata
gacttctaa

DBGET integrated database retrieval system