KEGG   Pongo abelii (Sumatran orangutan): 100437813Help
Entry
100437813         CDS       T01416                                 

Gene name
POMT2
Definition
(RefSeq) protein-O-mannosyltransferase 2
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100437813 (POMT2)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     100437813 (POMT2)
Glycosyltransferases [BR:pon01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100437813 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 757 aa AA seqDB search
MGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFLFQKPGDKYEHHSYIGMRGFCAFL
GSWLVPFAYLTVLDLSKSLSAALLTAALLTFDTGCLTLSQYILLDPILMFFIMAAMLSMV
KYNSCADRPFSAPWWFWLSLTGVSLAGALGVKFVGLFIILQVGLNTIADLWYLFGDLSLS
LVTVGKHLTARVLCLIVLPLALYTATFAVHFMVLSKSGPGDGFFSSAFQARLSGNNLHNA
SIPEHLAYGSVITVKNLRMAIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHN
TNSDPLDPSFPVEFVRHGDIIRLEHKETSRNLHSHYHEAPLTRKHYQVTGYGINGTGDSN
DFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGCVLGSSGKVLPKWGWEQLEVTCTPYLKET
LNSIWNVEDHINPKLPNISLDVLQPSFPEMLLESHMVMIRGNSGLKPKDNEFTSKPWHWP
INYQGLRFSGVNDTDFRVYLLGNPVVWWLNLLSITLYLLSGSIIAVAMQRGARLPAEVAG
PAARRRPGPARLDTPLLPVFPDGPGPLLPPLLPSHALLKHVDRHSVGHPPAALCLGLGLV
APGQGHTRGGNPEPAPGNRLQLLPLPPSGLRDGWSPGPGPPKSNGRTKVAGLMGLLRLLQ
RFQPGSRNFPVEPAGKQYWTHPAVRKLPKEPQEFCCPPGPSSGSAAGMEPSIGESRERAA
APSTAPQRGQHLSGCSLVHSAGEDGCQRVGVGARVCM
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgggaagttactatatcaaccgtacatttttctttgatgtgcacccacccctgggaaag
atgctgataggtcttgctggctacctgagtggatatgatggtacctttttgttccagaag
cctggggataaatatgagcatcacagctacataggaatgagaggattctgtgcattcctc
ggctcctggctggtcccctttgcctacctcactgtactggatctgtccaagtccctctcg
gcagcactgctcaccgctgccctcctcacctttgacacgggatgcctcactctgtcccag
tacatcctccttgaccccatcctgatgttcttcatcatggctgccatgctgagcatggtt
aagtacaactcctgtgccgacaggcccttctctgccccctggtggttctggctcagcctg
actggcgttagtcttgctggtgctttaggggtcaagtttgttggcctctttatcatcctt
caagtggggctgaacaccattgcagacctttggtacctgttcggagacctcagtctttca
ttggtgactgtgggaaaacacctgactgctcgtgtcctgtgcctcatagtgctgcccctg
gctctctacacagccacctttgctgttcacttcatggtgctgagtaaaagtggccctggt
gacggtttcttcagttctgccttccaggcccggctctcagggaacaacctgcacaatgct
tccatccctgaacacctggcctacggctctgtgatcactgtgaagaacctccggatggcc
atcggctatctgcactcccacaggcacctctaccccgagggcattggtgcccgtcagcag
caggtcaccacctatttgcacaaggactacaacaacctgtggattatcaagaaacataac
acaaactcagatcccctagacccttccttcccagtggagtttgtaagacatggagacatt
attcgactagaacacaaagaaacttcccggaacttgcacagtcactatcatgaggccccc
ctgacccggaagcactatcaggtcaccggctatggcataaatggaacaggggactcaaat
gatttctggcggattgaggtcgtaaacagaaaatttggaaaccggatcaaagtgctgaga
agtcgaattcgcttcatccatttggtcacaggttgtgtcctgggctcctcaggaaaggtt
ctgcccaagtggggctgggagcagttggaagttacttgcaccccatacctgaaagaaacc
ctcaactccatctggaatgtggaggaccatatcaatcccaagttgccaaacatcagcttg
gatgtgctgcagcccagttttcctgagatgttgctggaatcccacatggtcatgatccgg
gggaacagtggcctcaaacccaaggacaatgagttcacgtccaaaccctggcactggcct
atcaactatcagggcctacgcttctcaggggtcaatgacacagatttccgagtctatctg
cttggcaacccggtggtttggtggctcaatctgttgagcatcaccctctacctcctctca
gggagcatcattgctgtagccatgcagagaggggcacggctgccagcggaggttgcaggt
cctgctgcgaggaggcggccaggtcctgctcggctggacactccattacttcccgttttt
cctgatgggccgggtcctctacttccaccactacttcccagccatgctcttctcaagcat
gttgacaggcattctgtgggacaccctcctgcggctctgtgcctggggcttggcctcgtg
gcccctggccaggggcatacacgtggcgggaatcctgagcctgctcctgggaaccgccta
cagcttctacctcttccaccctctggcttacgggatggttggtcccctggcccaggaccc
ccaaagtccaatggcaggactaaggtggctggactcatgggacttttgaggctactgcaa
agattccagcctgggtccaggaacttcccagtagagccagctgggaagcagtactggacc
catccagccgtgaggaagctgcctaaggagccccaagaattctgctgcccaccaggaccc
agctctgggagtgcagctggaatggaacccagcattggagagagccgggagagagccgca
gctccatccacagcaccacagagaggacagcacctctcgggctgctcccttgtgcacagc
gcaggggaggatgggtgccagagggtgggagtgggtgcgcgtgtgtgtatgtga

DBGET integrated database retrieval system