KEGG   Pongo abelii (Sumatran orangutan): 100437819Help
Entry
100437819         CDS       T01416                                 

Gene name
USP8
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pon04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 1118 aa AA seqDB search
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEK
GAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLP
DDSKDTWKKRGNVEYVILLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESVPSKPAAQMPPASIEVDE
NIELISDQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEE
HRIKSESTNHEQQSPQNGKVIPDRSTKPVVFSPTLMLTDEEKARIHADTALLMEKSKQEK
ELRERQQEEQKEKLRKEEQEQKAKKKQEAEENEITEKQQKAKEEMEKKESEEAKKEDKET
SAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTPEVQKKSTGDVPHTSATGDSGSG
KPFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTRARSEEMGRIVPGLPSGWAKFLD
PITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSP
DITQAIQEEEKRKPTVTPAVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLR
NLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTG
QYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDH
LDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTS
KCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRW
KQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRW
FKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcttcagttcctaaagaactctacctcagttcttcactaaaagacctc
aataagaagacagaagttaaaccagagaaaataagcactaagagttatgtgcacagtgcc
ctgaagatctttaagacagcagaagaatgcagattagatcgtgatgaggaaagggcctat
gtactatatatgaaatacgtgactgtttataatcttatcaaaaaaagacctgatttcaag
caacagcaggattatttccattcaatacttggacctggaaacatcaaaaaagccgttgaa
gaagctgaaagactctctgaaagccttaaactaagatatgaagaagctgaagtccggaaa
aaacttgaggaaaaagacaggcaggaggaagcacagcggctacaacaaaaaaggcaggaa
acaggaagagaggatggtggcacattggctaaaggttctttggagaacgtattggattcc
aaagacaaaacccaaaagagcaatggtgaaaagaatgaaaaatgtgagaccaaagagaaa
ggagcaatcacagcaaaggaactatacacaatgatgacggataaaaacatcagcttgatt
ataatggatgctcgaagaatgcaggattatcaggattcctgtattttacattctctcagt
gttcctgaagaagccatcagtccaggagtcactgctagttggattgaagcacacctccca
gatgattctaaagacacatggaagaagagggggaatgtggagtatgtgatacttcttgac
tggtttagttctgccaaagatttacagattggaacaactctccggagtctgaaagacgca
cttttcaagtgggaaagtaaaactgtcctgcgcaatgagcctttggttttagagggaggc
tatgaaaactggctcctttgttatccccagtatacaacaaatgctaaggtcactccaccc
ccacgacgccagaatgaagaggtgtctatctcattggattttacttatccctcattggaa
gaatcagttccttctaaacctgctgcccagatgccacctgcatctatagaagtagatgaa
aatatagaattgataagtgatcaaaatgagagaatgggaccactgaatatatcaactcca
gttgaaccagttgctgcttctaaatctgatgtttcacccataattcagccagtgcctagt
ataaagaatgttccacagattgatcgtactaaaaaaccagcagtcaaattgcctgaagag
catagaataaaatctgaaagtacaaaccatgagcaacaatctcctcagaatggaaaagtt
attcctgatcgttccaccaagccagtagttttttctccaactctcatgttaacagatgaa
gaaaaggctcgtattcatgcggacactgctcttctaatggaaaaaagtaaacaagaaaaa
gaacttcgggaaaggcagcaagaggaacagaaagagaaactgaggaaggaagaacaagaa
caaaaagccaaaaagaaacaagaagctgaagaaaatgaaattacagagaagcaacaaaaa
gcaaaagaggaaatggagaagaaagaaagtgaagaggccaagaaagaagataaagaaacc
tcagcaaagaggggcaaagaaataacaggagtaaaaagacaaagtaaaagtgaacatgaa
acttctgatgccaagaaatctgtagaagatagggggaaaaggtgtccaaccccagaagta
cagaaaaagtcaacaggagatgtgccccatacatctgcgacaggggattcaggttcaggc
aagccatttaagattaaaggacaaccagaaagtggaattctaaggacaggaacttttaga
gaggatacagacgataccgaaagaaataaagctcaacgagaacctttgacaagagcacga
agtgaagaaatggggaggatcgtaccaggactgccttcaggctgggccaagtttcttgac
ccaatcactggaacctttcgttattaccattcacccaccaacaccgttcatatgtaccca
ccggaaatggctccttcatctgcacctccttccacccctccaactcataaagccaagcca
cagattcctgctgagcgggatagggaaccttccaaactgaagcgctcctactcctcccca
gatataacccaggctattcaagaggaagagaagaggaagccaacagtaactccagcagtt
aatcgggaaaacaagccaacatgttatcctaaagctgagatctcaaggctttctgcttct
cagattcggaacctcaatcctgtttttggaggttctggaccagctcttactggacttcgc
aacttaggaaatacttgttatatgaactcaatattgcagtgcctgtgtaatgctccacat
ttggctgattatttcaaccgaaactgttatcaggatgatattaacaggtcaaatttgttg
gggcataaaggtgaagtggcagaagaatttggtataatcatgaaagccctgtggacagga
cagtatagatatatcagtccaaaagactttaaaatcaccattgggaagatcaatgaccag
tttgcaggatacagtcagcaagattcacaagaattgcttctgttcctaatggatggtctc
catgaagatctaaataaagctgataatcggaagagatataaagaagaaaataatgatcat
ctcgatgactttaaagctgcagaacatgcctggcagaaacacaagcagctcaatgagtct
attattgttgcactttttcagggtcaattcaaatctacagtacagtgcctcacatgtcac
aaaaagtctaggacatttgaggccttcatgtatttgtctctaccgctagcatccacaagt
aaatgtacattacaggattgccttagattattttccaaagaagaaaaactcacagataac
aacagattttactgcagtcattgcagagctcgacgggattctctaaaaaagatagaaatc
tggaagttaccacctgtgcttttggtgcatctgaaacgtttttcctacgatggcaggtgg
aaacaaaaattacagacatctgtggacttcccgttagaaaatcttgacttgtcacagtat
gttattggtccaaagaacaatttgaagaaatataatttgttttctgtttcaaatcactac
ggtgggctggatggaggccactacacagcctattgtaaaaatgcagcaagacaacggtgg
tttaagtttgatgatcatgaagtttctgatatctccgtttcttctgtgaaatcttcagca
gcttatatcctcttttatacttcattgggaccacgagtaactgatgtagccacataa

DBGET integrated database retrieval system