KEGG   Pongo abelii (Sumatran orangutan): 100437824Help
Entry
100437824         CDS       T01416                                 

Gene name
USP7
Definition
ubiquitin specific peptidase 7 (herpes virus-associated)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
FoxO signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100437824 (USP7)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100437824 (USP7)
  Infectious diseases
   05168 Herpes simplex infection
    100437824 (USP7)
   05169 Epstein-Barr virus infection
    100437824 (USP7)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100437824 (USP7)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100437824 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 1069 aa AA seqDB search
MAGNHRLGLEAGDTDDPPRITQNPVINGNVALSDGHNNAEEDMEDDTSWRSEATFQFTVE
RFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQA
VLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQ
ADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSV
PLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCV
EGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIPAGLSLAAGQEAEKGV
KFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAV
LVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNA
YMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAED
QFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTK
RPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYD
PKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSL
DKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTL
SNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQP
KKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELGE
KASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVA
HFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINE
DEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggctgggaaccacaggcttgggctcgaagcgggagatacagatgacccaccaagaatt
actcagaaccctgtgatcaacgggaatgtggccctgagtgatggacacaacaacgcggag
gaggacatggaggatgacaccagttggcgctccgaggcaacctttcagttcactgtggag
cgcttcagcagactgagtgagtcggtccttagccctccatgttttgtgcgaaatctgcca
tggaagattatggtgatgccacgcttttatccagacagaccacaccaaaaaagcgtagga
ttctttctccagtgcaatgctgaatctgattccacgtcatggtcttgccatgcacaagca
gtgctgaagataataaattacagagatgatgaaaagtcgttcagtcgtcgtattagtcat
ttgttcttccataaagaaaatgattggggattttccaattttatggcctggagtgaagtg
accgatcctgagaaaggatttatagatgatgacaaagttacctttgaagtctttgtacag
gcggatgctccccatggagttgcgtgggattcaaagaagcacacaggctacgtcggctta
aagaatcagggagcgacttgttacatgaacagcctgctacagacgttatttttcacgaat
cagctacgaaaggctgtgtacatgatgccaaccgagggggatgattcgtctaaaagcgtc
cctttagcattacaaagagtgttctatgaattacagcacagtgataaacctgtaggaaca
aaaaagttaacaaaatcatttgggtgggaaactttagatagcttcatgcaacatgatgtt
caggagctttgtcgagtgttgcttgataatgtggaaaataagatgaaaggcacctgtgta
gagggcaccatacccaaattattccgcggcaaaatggtgtcctatatccagtgtaaagaa
gtagactatcggtctgatagaagagaagattattatgatatccagctaagtatcaaagga
aagaaaaatattcctgcaggtctctcgctggctgctgggcaggaagcagagaaaggtgtg
aaattcctaacattgccaccagtgttacatctacaactgatgagatttatgtatgaccct
cagacggaccaaaatatcaagatcaatgataggtttgaattcccagagcagttaccactt
gatgaatttttgcaaaaaacagatcctaaggaccctgcaaattatattcttcatgcagtc
ctggttcatagtggagataatcatggtggacattatgtggtttatctaaaccccaaaggg
gatggcaaatggtgtaaatttgatgacgacgtggtgtcaaggtgtactaaagaggaagca
attgagcacaattatgggggtcacgatgacgacctgtctgttcgacactgcactaatgct
tacatgttagtctatatcagggaatcaaaactgagtgaagttttacaggcggtcaccgac
catgatattcctcagcagttggtggagcgattacaagaagagaaaaggatcgaggctcag
aagcggaaggagcggcaggaagcccatctctatatgcaagtgcagatagtcgcagaggac
cagttttgtggccaccaaggaaatgacatgtacgatgaagaaaaagtgaaatacactgtg
ttcaaagtattgaagaactcctcgcttgccgagtttgttcagagcctctctcagaccatg
ggatttccacaagatcaaattcgattgtggcccatgcaagcaaggagtaatggaacaaaa
cggccagcaatgttagataatgaagccgacggcaataaaacaatgattgagctcagtgat
aatgaaaacccttggacaatattcctggaaacagttgatcccgagctggctgctagtgga
gcgaccttacccaagtttgataaagatcatgatgtaatgttatttttgaagatgtatgat
cccaaaacgcggagcttgaattactgtgggcatatctacacaccaatatcctgtaaaata
cgtgacttgctcccagttatgtgtgacagagcaggatttattcaagatactagccttatc
ctctatgaggaagttaaaccgaatttaacagagagaattcaggactatgacgtgtctctt
gataaagcccttgatgaactaatggatggtgacatcatagtatttcagaaggatgaccct
gaaaatgataacagtgaattacccaccgcaaaggagtatttccgagatctctaccaccgc
gttgatgtcattttctgtgataaaacaatccctaatgatcctggatttgtggttacgtta
tcaaatagaatgaattattttcaggttgcaaagacagttgcacagaggctcaacacagat
ccaatgttgctccagtttttcaagtctcaaggttatagggatggcccaggtaatcctctt
agacataattatgaaggtactttaagagatcttctacagttcttcaagcctagacaacct
aagaaactttactatcagcagcttaagatgaaaatcacagactttgagaacaggcgaagt
tttaaatgtatatggttaaacagccaatttagggaagaggaaataacactatatccagac
aagcatgggtgtgtccgggacctgttagaagaatgtaaaaaggccgtggagcttggggag
aaagcatcagggaaacttaggctgctagaaattgtaagctacaaaatcattggtgttcat
caagaagatgaactattagaatgtttatctcctgcaacgagccggacgtttcgaatagag
gaaatccctttggaccaggtggacatagacaaagagaatgagatgcttgtcacagtggcg
catttccacaaagaggtcttcggaacgttcggaatcccgtttttgctgaggatacaccag
ggcgagcattttcgagaagtgatgaagcgaatccagagcctactggacatccaggagaag
gagtttgagaagtttaaatttgcaattgtaatgatgggccgacaccagtacataaatgaa
gacgagtatgaagtaaatttgaaagactttgagccacagcccggtaatatgtctcatcct
cggccttggctagggctcgaccacttcaacaaagccccaaagaggagtcgctacacttac
cttgaaaaggccattaaaatccataactga

DBGET integrated database retrieval system