KEGG   Pongo abelii (Sumatran orangutan): 100437824Help
Entry
100437824         CDS       T01416                                 

Gene name
USP7
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 7
  KO
K11838  ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04068  FoxO signaling pathway
pon05168  Herpes simplex infection
pon05169  Epstein-Barr virus infection
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100437824 (USP7)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100437824 (USP7)
  Infectious diseases
   05168 Herpes simplex infection
    100437824 (USP7)
   05169 Epstein-Barr virus infection
    100437824 (USP7)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100437824 (USP7)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100437824 (USP7)
Ubiquitin system [BR:pon04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100437824 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: USP7_ICP0_bdg USP7_C2 UCH UCH_1 MATH
Motif
Other DBs
NCBI-GeneID: 100437824
NCBI-ProteinID: XP_024089274
Ensembl: ENSPPYG00000007087
Position
16
AA seq 1102 aa AA seqDB search
MNHQQQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVALSDGHNNAEEDME
DDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQ
CNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPE
KGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRK
AVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELC
RVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNI
FESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIK
INDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKF
DDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQL
VERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNS
SLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTI
FLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVM
CDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSEL
PTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFF
KSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLN
SQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLE
CLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREV
MKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLD
HFNKAPKRSRYTYLEKAIKIHN
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccagcagcagcagcagcagcagaaagcgggcgagcagcagttgagcgagccc
gaggacatggagatggaagcgggagatacagatgacccaccaagaattactcagaaccct
gtgatcaacgggaatgtggccctgagtgatggacacaacaacgcggaggaggacatggag
gatgacaccagttggcgctccgaggcaacctttcagttcactgtggagcgcttcagcaga
ctgagtgagtcggtccttagccctccatgttttgtgcgaaatctgccatggaagattatg
gtgatgccacgcttttatccagacagaccacaccaaaaaagcgtaggattctttctccag
tgcaatgctgaatctgattccacgtcatggtcttgccatgcacaagcagtgctgaagata
ataaattacagagatgatgaaaagtcgttcagtcgtcgtattagtcatttgttcttccat
aaagaaaatgattggggattttccaattttatggcctggagtgaagtgaccgatcctgag
aaaggatttatagatgatgacaaagttacctttgaagtctttgtacaggcggatgctccc
catggagttgcgtgggattcaaagaagcacacaggctacgtcggcttaaagaatcaggga
gcgacttgttacatgaacagcctgctacagacgttatttttcacgaatcagctacgaaag
gctgtgtacatgatgccaaccgagggggatgattcgtctaaaagcgtccctttagcatta
caaagagtgttctatgaattacagcacagtgataaacctgtaggaacaaaaaagttaaca
aaatcatttgggtgggaaactttagatagcttcatgcaacatgatgttcaggagctttgt
cgagtgttgcttgataatgtggaaaataagatgaaaggcacctgtgtagagggcaccata
cccaaattattccgcggcaaaatggtgtcctatatccagtgtaaagaagtagactatcgg
tctgatagaagagaagattattatgatatccagctaagtatcaaaggaaagaaaaatata
tttgaatcatttgtggattatgtggcagtagaacagctcgatggggacaataaatacgac
gctggggaacatggcttacaggaagcagagaaaggtgtgaaattcctaacattgccacca
gtgttacatctacaactgatgagatttatgtatgaccctcagacggaccaaaatatcaag
atcaatgataggtttgaattcccagagcagttaccacttgatgaatttttgcaaaaaaca
gatcctaaggaccctgcaaattatattcttcatgcagtcctggttcatagtggagataat
catggtggacattatgtggtttatctaaaccccaaaggggatggcaaatggtgtaaattt
gatgacgacgtggtgtcaaggtgtactaaagaggaagcaattgagcacaattatgggggt
cacgatgacgacctgtctgttcgacactgcactaatgcttacatgttagtctatatcagg
gaatcaaaactgagtgaagttttacaggcggtcaccgaccatgatattcctcagcagttg
gtggagcgattacaagaagagaaaaggatcgaggctcagaagcggaaggagcggcaggaa
gcccatctctatatgcaagtgcagatagtcgcagaggaccagttttgtggccaccaagga
aatgacatgtacgatgaagaaaaagtgaaatacactgtgttcaaagtattgaagaactcc
tcgcttgccgagtttgttcagagcctctctcagaccatgggatttccacaagatcaaatt
cgattgtggcccatgcaagcaaggagtaatggaacaaaacggccagcaatgttagataat
gaagccgacggcaataaaacaatgattgagctcagtgataatgaaaacccttggacaata
ttcctggaaacagttgatcccgagctggctgctagtggagcgaccttacccaagtttgat
aaagatcatgatgtaatgttatttttgaagatgtatgatcccaaaacgcggagcttgaat
tactgtgggcatatctacacaccaatatcctgtaaaatacgtgacttgctcccagttatg
tgtgacagagcaggatttattcaagatactagccttatcctctatgaggaagttaaaccg
aatttaacagagagaattcaggactatgacgtgtctcttgataaagcccttgatgaacta
atggatggtgacatcatagtatttcagaaggatgaccctgaaaatgataacagtgaatta
cccaccgcaaaggagtatttccgagatctctaccaccgcgttgatgtcattttctgtgat
aaaacaatccctaatgatcctggatttgtggttacgttatcaaatagaatgaattatttt
caggttgcaaagacagttgcacagaggctcaacacagatccaatgttgctccagtttttc
aagtctcaaggttatagggatggcccaggtaatcctcttagacataattatgaaggtact
ttaagagatcttctacagttcttcaagcctagacaacctaagaaactttactatcagcag
cttaagatgaaaatcacagactttgagaacaggcgaagttttaaatgtatatggttaaac
agccaatttagggaagaggaaataacactatatccagacaagcatgggtgtgtccgggac
ctgttagaagaatgtaaaaaggccgtggagcttggggagaaagcatcagggaaacttagg
ctgctagaaattgtaagctacaaaatcattggtgttcatcaagaagatgaactattagaa
tgtttatctcctgcaacgagccggacgtttcgaatagaggaaatccctttggaccaggtg
gacatagacaaagagaatgagatgcttgtcacagtggcgcatttccacaaagaggtcttc
ggaacgttcggaatcccgtttttgctgaggatacaccagggcgagcattttcgagaagtg
atgaagcgaatccagagcctactggacatccaggagaaggagtttgagaagtttaaattt
gcaattgtaatgatgggccgacaccagtacataaatgaagacgagtatgaagtaaatttg
aaagactttgagccacagcccggtaatatgtctcatcctcggccttggctagggctcgac
cacttcaacaaagccccaaagaggagtcgctacacttaccttgaaaaggccattaaaatc
cataactga

DBGET integrated database retrieval system