KEGG   Pongo abelii (Sumatran orangutan): 100438048Help
Entry
100438048         CDS       T01416                                 

Gene name
ART5
Definition
ADP-ribosyltransferase 5
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100438048 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 327 aa AA seqDB search
MPGDRVQICLEPLETRTPAPLVPPSPGPLALMSPPGMALAALMIALGSLGLHTWQAQAVP
ILPLGLAPATFDDAYVGCAEEMEEKAAPLLKEEMAHHALLRESWEAAQEAWEDKRQGLTL
PPGFKAQNGIAIMVYTNSSNTLYWELNQAVRMGGGSRELYMRHFPYKALHFYLIRALQLL
RGSGGCSRGPGEVVFRGVGSLHFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLMT
CFGAPIQAFSVFPKEHEVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGE
KRRGCVSAPGALGTGDLHMKKRRLQQP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcctggagacagggtccagatctgcctcgagcccctcgaaaccaggactccagcacct
ctggtcccgccctcacccggacccctggccctcatgtctcctccagggatggcgctggcg
gctttgatgatcgccctcggcagccttggcctccacacctggcaggcccaggctgttccc
atcctgcccctgggcctggctccagccacctttgacgatgcctatgtgggttgtgcagag
gagatggaggagaaggcagctcccctgctaaaggaggaaatggcccaccatgccctgctg
cgggaatcctgggaggcagcccaggaggcctgggaggacaagcgtcaagggctcaccttg
ccccctggcttcaaagcccagaatggaatagccattatggtctacaccaactcatcgaac
accttgtactgggagttgaatcaggccgtgcggatgggtggaggctcccgggagctctac
atgaggcactttccctacaaggccctgcatttctacctgatccgggccctgcagctgctg
cgaggcagtgggggctgcagcaggggacctggggaggtggtgttccgaggtgtgggcagc
cttcactttgaacccaagaggctaggggactctgtccgcttaggccagtttgcctccagc
tccctggataaggcagtggcccacagatttggtaatgccaccctcttctctctaatgact
tgctttggggcccctatacaggccttctctgtctttcccaaggagcacgaggtgctgatt
cccccccatgaagtctttttggttaccagattctctcaggatggagcccagagcctggtg
actctctggagctataatcagacctgtagccactttaactgcgcctatctgggtggggag
aagaggcggggctgtgtgtctgcgccaggagccctgggaacgggtgaccttcatatgaag
aagaggcgcctccagcagccttga

DBGET integrated database retrieval system