KEGG   Pongo abelii (Sumatran orangutan): 100438178Help
Entry
100438178         CDS       T01416                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X1
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04727  GABAergic synapse
pon04742  Taste transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing's syndrome
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon04962  Vasopressin-regulated water reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05032  Morphine addiction
pon05166  HTLV-I infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy (DCM)
Module
pon_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100438178 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100438178 (ADCY6)
   04371 Apelin signaling pathway
    100438178 (ADCY6)
   04072 Phospholipase D signaling pathway
    100438178 (ADCY6)
   04024 cAMP signaling pathway
    100438178 (ADCY6)
   04022 cGMP - PKG signaling pathway
    100438178 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100438178 (ADCY6)
  Cellular community - eukaryotes
   04540 Gap junction
    100438178 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100438178 (ADCY6)
   04062 Chemokine signaling pathway
    100438178 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    100438178 (ADCY6)
   04923 Regulation of lipolysis in adipocyte
    100438178 (ADCY6)
   04912 GnRH signaling pathway
    100438178 (ADCY6)
   04913 Ovarian Steroidogenesis
    100438178 (ADCY6)
   04915 Estrogen signaling pathway
    100438178 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100438178 (ADCY6)
   04921 Oxytocin signaling pathway
    100438178 (ADCY6)
   04926 Relaxin signaling pathway
    100438178 (ADCY6)
   04918 Thyroid hormone synthesis
    100438178 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    100438178 (ADCY6)
   04916 Melanogenesis
    100438178 (ADCY6)
   04924 Renin secretion
    100438178 (ADCY6)
   04925 Aldosterone synthesis and secretion
    100438178 (ADCY6)
   04927 Cortisol synthesis and secretion
    100438178 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100438178 (ADCY6)
   04270 Vascular smooth muscle contraction
    100438178 (ADCY6)
  Digestive system
   04970 Salivary secretion
    100438178 (ADCY6)
   04971 Gastric acid secretion
    100438178 (ADCY6)
   04972 Pancreatic secretion
    100438178 (ADCY6)
   04976 Bile secretion
    100438178 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100438178 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100438178 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    100438178 (ADCY6)
   04727 GABAergic synapse
    100438178 (ADCY6)
   04725 Cholinergic synapse
    100438178 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100438178 (ADCY6)
  Sensory system
   04742 Taste transduction
    100438178 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100438178 (ADCY6)
  Aging
   04211 Longevity regulating pathway - mammal
    100438178 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    100438178 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    100438178 (ADCY6)
   04714 Thermogenesis
    100438178 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100438178 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    100438178 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100438178 (ADCY6)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100438178 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    100438178 (ADCY6)
  Drug resistance
   01522 Endocrine resistance
    100438178 (ADCY6)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100438178 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 Shisa CstA
Motif
Other DBs
NCBI-GeneID: 100438178
NCBI-ProteinID: XP_024112797
Ensembl: ENSPPYG00000004466
Position
12
AA seq 1118 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
PRCPWQDDTFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDTVSRSGRSCWR
RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAY
VALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSASAGLW
CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQERLLLSVLPQHV
AMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFAR
FDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVN
MRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEV
EPGRGGERNAYLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAF
SRTKDSKAFRQMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLL
TFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLI
TVLICAVYSCGSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNYTPIR
TCAARMLNLTPADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVF
LHISSIGKLAMIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAG
RVALKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHN
ILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNE
IIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQM
KHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTT
DLYQVLAAKGYQLECRGLVKVKGKGEMTTYFLNGGPSS
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtccctaaagtggatgaacggaaaacagcctggggt
gaacgcaatgggcagaagcgttcgcggcgccgtggcactcgggcaggtggcttctgcacg
ccccgctatatgagctgcctccgggatgcagagccacccagccccacccctgcgggcccc
cctcggtgcccctggcaggatgacaccttcatccggaggggcggcccaggcaagggcaag
gagctggggctgcgggcagtggccctgggcttcgaggataccgaggtgacaacgacagcg
ggcgggacggctgaggtggcgcccgacacggtgtccaggagtgggcgatcctgctggcgc
cgtctggtgcaggtgttccagtcgaagcagttccgttcggccaagctggagcgcctgtac
cagcggtacttcttccagatgaaccagagcagcctgacgctgctgatggcggtgctggtg
ctgctcacggcggtgctgctggctttccacgccgcacccgcccgccctcagcctgcctat
gtggcactgttggcctgtgccgccgccctgttcgtggggctcatggtggtgtgtaaccgg
catagcttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcg
gcagtgcaggtcgggggcgccctcgcagcagacccgcgcagcgcctctgcgggcctctgg
tgccctgtgttctttgtctacatcgcctacaccctcctccccatccgcatgcgggctgcc
gtcctcagcggcctgggcctctccaccttgcatttgatcttggcctggcaacttaaccgt
ggtgatgccttcctctggaagcaggagcggctgctgctgtcggtattgccccagcacgtt
gccatggagatgaaagaagacatcaacacaaaaaaagaagacatgatgttccacaagatc
tacatacagaagcatgacaatgtcagcatcctgtttgcagacattgagggcttcactagc
ctggcatcccagtgcaccgcgcaggagctggtcatgaccctgaatgagctctttgcccgg
tttgacaagctggctgcggagaatcactgcctgaggatcaagatcttgggggactgttac
tactgtgtgtcagggctgccggaggcccgggccgaccatgcccactgctgtgtggagatg
ggggtagacatgatcgaggccatctcgctggtacgtgaggtgacaggtgtgaatgtgaac
atgcgcgtgggcatccacagcgggcgcgtgcactgcggcgtccttggcttgcggaaatgg
cagtttgatgtgtggtccaatgatgtgaccctggccaaccacatggaggcaggaggccgg
gctggccgcatccacatcactcgggcaacactgcagtacctgaacggggactacgaggtg
gagccaggccgtggtggtgagcgcaacgcgtacctcaaggagcagcacattgagactttc
ctcatcctgggcgccagccagaaacggaaagaggagaaggccatgctggccaagctgcag
cggactcgggccaactccatggaagggctgatgccgcgctgggtgcctgatcgcgccttc
tcccggaccaaggactccaaggccttccgccagatgggcattgatgattccagcaaagac
aaccggggcacccaagatgccctgaaccctgaggatgaggtggatgagttcctgagccgt
gccatcgatgcccgcagcattgatcagctgcggaaggaccatgtgcgccggtttctgctc
accttccagagagaggatcttgagaagaagtactcccggaaggtggatccccgctttgga
gcctacgttgcctgtgccctgttggtcttctgcttcatctgcttcatccagcttctcatc
ttcccacactccaccctgatgcttgggatctatgccagcatcttcctgctgctgctgatc
accgttctgatctgtgccgtgtactcctgtggttctctgttccctaaggccctgcaacgt
ctgtcccgcagcattgtccgctcacgggcacatagcaccgcagttggcatcttttccgtc
ctgctagtgtttacttctgccattgccaacatgttcacctgtaactacacccccatacgg
acatgtgcagcccggatgctgaatttaacacctgctgacatcactgcctgccacctgcag
cagctcaattactctctgggcctggatgctcccctgtgtgagggcaccatgcccacctgc
agcttccctgagtacttcatcgggaacatgctgctgagtctcttggccagctctgtcttc
ctgcacatcagcagcatcgggaagttggccatgatctttgtcttggggctcatctatttg
gtgctgcttctgctgggtcccccagccaccatctttgacaactatgacctactgcttggc
gtccatggcttggcttcttccaatgagacctttgatgggctggactgtccagctgcaggg
agggtggccctcaaatatatgacccctgtgattctgctggtgtttgctctggcgctgtat
ctgcatgctcagcaggtggagtcgactgcccgcctagacttcctctggaaactacaggca
acaggggagaaggaggagatggaggagctacaggcatacaaccggaggctgctgcataac
attctgcccaaggacgtggcggcccatttcctggcccgggagcgccgcaatgatgaactc
tactatcagtcgtgtgagtgtgtggcggttatgtttgcctccattgccaacttctctgag
ttctatgtggagctggaggcaaacaatgagggtgtcgagtgcctgcggctgctcaacgag
atcatcgctgactttgatgagattatcagcgaggagcggttccggcagctggaaaagatc
aagacgattggtagcacctacatggctgcctcagggctgaacgccagcacctacgatcag
gtgggccgctcccatatcactgccctggctgactacgccatgcggctcatggagcagatg
aagcacatcaatgagcactccttcaacaatttccagatgaagattgggctgaacatgggc
ccagtcgtggcaggtgtcatcggggctcggaagccacagtatgacatctgggggaacaca
gtgaatgtctctagtcgtatggacagcacgggggtccccgaccgaatccaggtgaccacg
gacctgtaccaggttctagctgccaagggctaccagctggagtgtcgagggctggtcaag
gtgaagggcaagggggagatgaccacctacttcctcaatgggggccccagcagttag

DBGET integrated database retrieval system