KEGG   Pongo abelii (Sumatran orangutan): 100438440Help
Entry
100438440         CDS       T01416                                 

Definition
mitogen-activated protein kinase 4-like
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 376 aa AA seqDB search
MWAAGCILAEMLTGRMLFAGAHELEQMQLILETIPVIREEDKDELLRVMPSFVSSTWEVK
RPLRKLLPEVNSEAIDFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIE
DEIDDIVLMAANQSQLSNWDTCSSRYPVSLSSDLEWRPDRCQDASEVQRDPRAGSAPLAE
DVQVDPRKDSHSSSERFLEQSHSSMERAFEADYGRSCDYKVGSPSYLDKLLWRDNKPHHY
SEPKLILDLSHWKQAAGAPPTATGLADTGAREDEPASLFLEIAQWVKSTQGGPEHASPPA
DDPERRLSASPPGHPAPVDGGASPQFDLDVFISRALKLCTKPEDLPDNKLGDLNGACIPE
HPGDLVQTEAFSKERW
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccgccggctgcatcctggctgagatgcttacggggagaatgctctttgctggg
gcccatgagctggagcagatgcaactgatcctggagaccatccctgtaatccgggaggaa
gacaaggacgagctgctcagggtgatgccttcctttgtcagcagcacctgggaggtgaag
aggcctctgcgcaagctgctccccgaagtgaacagtgaagccatcgactttctggagaag
atcctgacctttaaccccatggatcgcctaacagctgagatggggctgcaacacccctac
atgagcccatactcgtgccctgaggacgagcccacctcgcaacaccccttccgcattgag
gatgagattgacgacatcgtgctgatggccgctaaccagagccagctgtccaactgggac
acgtgcagttccaggtaccctgtgagcctgtcgtcggacctggagtggcggcctgaccgg
tgccaggacgccagcgaggtgcagcgcgacccgcgcgcgggttcggcgccgctggccgag
gacgtgcaggtggacccgcgcaaggactcgcacagcagctccgagcgcttcctagagcag
tcgcattcgtccatggagcgtgccttcgaggccgactacgggcgctcctgcgactacaag
gtggggtcgccgtcctacctggacaagctgctgtggcgcgataacaagccgcaccactac
tcggagcccaagctcatcctggacctgtcgcactggaagcaggcggccggcgcgccccct
acggcaacggggctggcagacacgggggcgcgcgaggacgagccggccagcctcttcctg
gagatcgcgcagtgggtcaagagcacgcagggcggccccgagcacgccagcccgcccgcc
gacgaccccgagcgccgcttgtctgcctcgccccccggccacccggccccggtggacggc
ggcgccagcccccagttcgacctggacgtgttcatctcccgcgccctgaagctctgcacc
aagcccgaggacctgccggacaataaactgggcgacctcaatggtgcgtgcatccccgag
caccctggcgacctcgtgcagaccgaggccttctccaaagaaaggtggtga

DBGET integrated database retrieval system