KEGG   Pongo abelii (Sumatran orangutan): 100438808Help
Entry
100438808         CDS       T01416                                 

Gene name
HAT1
Definition
(RefSeq) histone acetyltransferase type B catalytic subunit isoform X1
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    100438808 (HAT1)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100438808 (HAT1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100438808 (HAT1)
   HAT complexes
    HATB complex
     100438808 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hat1_N Acetyltransf_10 Acetyltransf_7 Acetyltransf_1
Motif
Other DBs
NCBI-GeneID: 100438808
NCBI-ProteinID: XP_002812633
Position
2B
AA seq 447 aa AA seqDB search
MSDCAVTSGPGARGLIRPSSAAGARSSEMAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTA
IELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYA
SKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPT
GGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDG
ATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLD
ITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVY
EILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEIS
MQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtcagactgcgcggtcacttccggcccgggagcgcgcgggttgattcgtccttcctca
gccgcgggtgctcgtagctcggaaatggcgggatttggtgctatggagaaatttttggta
gaatataagagtgcagtggagaagaaactggcagagtacaaatgtaacaccaacacagca
attgaactaaaattagttcgttttcctgaagatcttgaaaatgacattagaactttcttt
cctgagtatacccatcaactctttggggatgatgaaactgcttttggttacaagggtcta
aagatcctgttatactatattgctggtagcctgtcaacaatgttccgtgttgaatatgca
tctaaagttgatgagaactttgactgtgtagaggcagatgatgttgagggcaaaattaga
caaatcattccacctggattttgcacaaacacgaatgatttcctttctttactggaaaag
gaagttgatttcaagccattcggaaccttacttcatacctactcagttctcagtccaaca
ggaggagaaaactttacctttcagatatataaggctgacatgacatgtagaggctttcga
gaatatcatgaaaggcttcagacctttttgatgtggtttattgaaactgctagctttatt
gacgtggatgatgaaagatggcactactttctagtatttgagaagtataataaggatgga
gctacgctctttgcgaccgtaggctacatgacagtctataattactatgtgtacccagac
aaaacccggccacgtgtaagtcagatgctgattttgactccatttcaaggtcaaggccat
ggtgctcaacttcttgaaacagttcatagatactacactgaatttcctacagttcttgat
attacagcggaagatccatccaaaagctatgtaaaattacgagactttgtgcttgtgaag
ctttgtcaagatttgccctgtttttcccgggaaaaattaatgcaaggattcaatgaagat
atggcgatagaggcacaacagaagttcaaaataaataagcaacatgctagaagagtttat
gaaattcttcgactactggtaactgacatgagtgatgccgaacaatacagaagctataga
ctggatattaaaagaagactaattagcccatataagaaaaagcagagagatcttgctaag
atgagaaaatgtctcagaccagaagaactgacaaaccagatgaaccaaatagaaataagc
atgcaacatgaacagctggaagagagttttcaggaactagtggaagattaccggcgtgtt
attgaacgacttgctcaagagtaa

DBGET integrated database retrieval system