KEGG   Pongo abelii (Sumatran orangutan): 100438808Help
Entry
100438808         CDS       T01416                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    100438808 (HAT1)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100438808 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2B
AA seq 334 aa AA seqDB search
MFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHT
YSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVF
EKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYT
EFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINK
QHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQ
MNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtgttgaatatgcatctaaagttgatgagaactttgactgtgtagaggcagat
gatgttgagggcaaaattagacaaatcattccacctggattttgcacaaacacgaatgat
ttcctttctttactggaaaaggaagttgatttcaagccattcggaaccttacttcatacc
tactcagttctcagtccaacaggaggagaaaactttacctttcagatatataaggctgac
atgacatgtagaggctttcgagaatatcatgaaaggcttcagacctttttgatgtggttt
attgaaactgctagctttattgacgtggatgatgaaagatggcactactttctagtattt
gagaagtataataaggatggagctacgctctttgcgaccgtaggctacatgacagtctat
aattactatgtgtacccagacaaaacccggccacgtgtaagtcagatgctgattttgact
ccatttcaaggtcaaggccatggtgctcaacttcttgaaacagttcatagatactacact
gaatttcctacagttcttgatattacagcggaagatccatccaaaagctatgtaaaatta
cgagactttgtgcttgtgaagctttgtcaagatttgccctgtttttcccgggaaaaatta
atgcaaggattcaatgaagatatggcgatagaggcacaacagaagttcaaaataaataag
caacatgctagaagagtttatgaaattcttcgactactggtaactgacatgagtgatgcc
gaacaatacagaagctatagactggatattaaaagaagactaattagcccatataagaaa
aagcagagagatcttgctaagatgagaaaatgtctcagaccagaagaactgacaaaccag
atgaaccaaatagaaataagcatgcaacatgaacagctggaagagagttttcaggaacta
gtggaagattaccggcgtgttattgaacgacttgctcaagagtaa

DBGET integrated database retrieval system