KEGG   Pongo abelii (Sumatran orangutan): 100438875Help
Entry
100438875         CDS       T01416                                 

Gene name
SYK
Definition
(RefSeq) tyrosine-protein kinase SYK isoform X1
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04064  NF-kappa B signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04380  Osteoclast differentiation
pon04611  Platelet activation
pon04625  C-type lectin receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon05152  Tuberculosis
pon05167  Kaposi's sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    100438875 (SYK)
   04072 Phospholipase D signaling pathway
    100438875 (SYK)
   04151 PI3K-Akt signaling pathway
    100438875 (SYK)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100438875 (SYK)
   04625 C-type lectin receptor signaling pathway
    100438875 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    100438875 (SYK)
   04662 B cell receptor signaling pathway
    100438875 (SYK)
   04664 Fc epsilon RI signaling pathway
    100438875 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    100438875 (SYK)
  Development
   04380 Osteoclast differentiation
    100438875 (SYK)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100438875 (SYK)
  Infectious diseases
   05152 Tuberculosis
    100438875 (SYK)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100438875 (SYK)
   05169 Epstein-Barr virus infection
    100438875 (SYK)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100438875 (SYK)
Protein kinases [BR:pon01001]
 Non-receptor tyrosine kinases
  SYK family
   100438875 (SYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100438875
NCBI-ProteinID: XP_024108425
Position
9
AA seq 635 aa AA seqDB search
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKPSPAQGNRQESTVSFNPYEPELASWAAEKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRNLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKNELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagcggcatggctgacagcgccaaccacctgcccttctttttcggcaatatc
acccgggaggaggcagaagattacctggtccaggggggcatgagtgatgggctctatttg
ctgcgccagagccgcaactacctgggcggcttcgccctgtccgtggcccacgggaggaag
gcacaccactacaccatcgagcgggagctgaacggcacctacgccatcgccggcggcagg
acccatgccagccccgccgacctctgccactaccactcccaggagtctgatggcctggtc
tgcctcctcaagaagcccttcaaccggccccaaggggtgcagcccaagactgggcccttt
gaggacttgaaggaaaacctcatcagggaatatgtgaagcagacatggaacctgcagggt
caggctctggaacaggccatcatcagtcagaagcctcagctggagaagctgatcgccacc
acagcccatgaaaaaatgccttggttccatggaaaaatctctcgggaagaatctgagcaa
attgtcctgataggatcaaagacaaatggaaagttcctgatccgagccagagacaacaac
ggttcctacgccctgtgcctgctgcacgaagggaaggtgctgcactatcgcatcgacaaa
gacaagacagggaagctctccatccccgagggaaagaagttcgacacgctctggcagctg
gtcgagcattattcttataaagcagatggtttgttaagagttcttactgtcccatgtcaa
aaaatcggcacacagggaaatgttaattttggaggccgtccacaacttccaggttcccat
cctgcgacttggtcagcgggtggaataatctcaagaatcaaatcatactccttcccaaag
cctggccacagaaagccctcccctgcccaagggaaccggcaagagagtactgtgtcgttc
aatccgtatgagccagaacttgcatcctgggctgcagaaaaaggcccccagagagaagcc
ctacccatggacacagaggtgtacgagagcccctacgcagaccccgaggagatcaggccc
aaggaggtttatctggaccgaaatctgctgacgctggaagacaaagaactgggctctggt
aattttggaactgtgaaaaagggctactaccaaatgaaaaaagttgtgaaaaccgtggct
gtgaaaatactgaaaaacgaggccaatgaccccgctcttaaaaatgagttattagcagaa
gcaaatgtcatgcagcagctggacaacccgtacatcgtgcgcatgatcgggatatgcgag
gccgagtcctggatgctggttatggagatggcagaacttggtcccctcaataagtatttg
cagcagaacagacatgtcaaggataaaaacatcatagaactggttcatcaggtttccatg
ggcatgaaatatttggaggagagcaattttgtgcacagagatctggctgcaagaaatgtg
ttgctagttactcaacattacgccaagatcagtgattttggactttccaaagcactgcgt
gctgatgaaaactactacaaggcccagacccatggaaagtggcctgtcaagtggtacgct
ccagaatgcatcaactactacaagttctccagcaaaagcgatgtctggagctttggagtg
ttgatgtgggaagcattctcctatgggcagaagccgtatcgagggatgaaaggaagtgaa
gtcactgctatgttagagaaaggagagcggatggggtgccctgcagggtgtccaagagag
atgtacgatctcatgaatctgtgctggacatatgatgtggaaaacaggcccggattcgca
gcagtggaactgcggctgcgcaattactactatgacgtggtgaactaa

DBGET integrated database retrieval system