KEGG   Pongo abelii (Sumatran orangutan): 100438940Help
Entry
100438940         CDS       T01416                                 

Definition
ubiquitin carboxyl-terminal hydrolase 32
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100438940
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100438940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 1149 aa AA seqDB search
MSSKRPTIICLLQSTSNCILEAQICFEIPYQMLEGRFVNQKFSGLVIRFSVTEYEASWPL
KVLGLQVIYCSFGGTSKGLHFNNLIVGLVLLTRGKDEEKAKYIFSLFSSESGNYVIREEM
ERMLHVVDGKVPDTLRKCFSEGEKVNYEKFRNWLFVNKDAFTFSRWLLSGGVYVTLTDDS
DTPTFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGL
FNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVFAL
LEVWKDNRTDDIPELHMDLSDIVEGILNAHDTTKFGHLTLEDYQIWSVKNVLANEFLNLL
FQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKYDAS
PVVIEPSSVLNGGKYSFGTAAHPMEQVEDRIGSSLSYVNTTEEKFSDNISTASEASETAG
SGFLYSATPGADVCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVTQEPVK
ATSLTLEGGRLKRTPQLIHRRDYEMVPEPVWRALYHWYGANLALPRPVIKNSKTDIPELE
LFPRYLLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLS
QRLRIKEEDMRLWLYNSENYLTLLDDEDHKLEYLKIQDEQHLVIEVRNKDMSWPEEMSFI
ANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNP
IGMKGHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDG
LHEDLNRVHEKPYVELKDSDGRPNWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKTC
GHISVRFDPFNFLSLPLPMDSYMHLEITVIRLDGTTPVRYGLRLNMDEKYTGLKKQLSDL
CGLNSEQILLAEVHGSNIKNFPQDNQKVRLSVSGFLCAFEIPVPASPISASSPTQTDFSS
SPSTNGMFTLTTNGDLPRPIFIPNGMPNTVVPCGTEKNFTNGMVNGHMPSLPDSPFTGYI
IAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPLPPQ
EASNHAQDW
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaaaaaggccaaccatcatttgcctcctgcagagcaccagtaactgtattctg
gaagcacagatctgttttgaaatcccatatcagatgctggaagggaggtttgtgaatcag
aagttcagtggacttgtgataaggttcagtgtcacagagtacgaggcctcttggcctctg
aaagtgctgggattacaggtgatttactgttcttttggtggaacatccaaagggctgcac
ttcaataatttaatagttggacttgtcctccttacaagaggcaaagatgaagagaaagca
aaatacatttttagtcttttttcaagtgaatctgggaactatgttatacgggaagaaatg
gaaagaatgctccatgtggtggatggtaaagtcccagatacactcaggaaatgtttctca
gagggtgaaaaggtaaactatgaaaagtttagaaattggctttttgtaaacaaagatgct
tttactttctctcgatggcttctatctggaggtgtgtatgttaccctcactgatgacagt
gatactcctactttctaccaaactctggctggagtcacacatttggaggaatcagacatc
attgatcttgagaaacgctattggttattgaaggctcaatcccggactggacgatttgat
ttagagacatttggcccattggtttcaccacctattcgtccatctctaagtgaaggtttg
tttaatgcttttgatgaaaatcgtgacaatcacatagattttaaggagatatcctgtggg
ttatcagcctgttgcaggggacccctggctgaaagacaaaaattttgcttcaaggtattt
gatgttgaccgtgacggagttctctccagggttgaactgagagacatggtgtttgcactt
ttagaagtctggaaggacaaccgcactgatgatattcctgaattacatatggatctctct
gacattgtagaaggcatattgaatgcacatgacaccacaaagttcggtcatcttactctg
gaagactatcagatctggagtgtgaaaaatgttcttgccaatgagtttctgaacctcctt
ttccaggtgtgtcacatagttctggggttaagaccagctactccggaagaagaaggacaa
attattagaggatggttagaacgagagagcaggtatggtctgcaaccaggacacaactgg
tttatcatctccatgcagtggtggcaacagtggaaagaatatgtcaaatacgatgccagc
cctgtggtaattgagccatcatctgttttgaatggaggaaaatactcatttggaactgca
gcccatcctatggagcaggtcgaagatagaattggaagcagcctcagttatgtgaatact
acagaagagaaattttcagacaacatttctactgcatctgaagcctcagaaactgctggc
agcggctttctgtattctgccacaccaggggcagatgtttgctttgctcgacaacataac
acttctgacaataacaaccagtgtttgctgggagccaatgggaatattttgttgcacctt
aaccctcagaaaccaggggctattgataatcagccattagtaactcaagaaccagtaaag
gctacatcattaacgctagaaggaggacgattaaaacgaactccacagctgattcacaga
agagattatgaaatggtcccagaacctgtgtggagagcactttatcactggtatggagca
aacctggccttacctagaccagttatcaagaacagcaagacagacatcccagagctggaa
ttatttccccgctatcttctcttcctgagacagcagcctgccactcggacacagcagtct
aacatctgggtgaatatgggaaatgtaccttctccgaatgcacctttaaagcgggtgtta
gcctatacaggctgttttagtcgaatgcagaccatcaaggaaattcacgaatatctatct
caaaggctgcgtattaaagaggaagatatgcgcctgtggctatacaacagtgagaactac
cttactcttctggatgatgaggatcataaattggaatatttgaaaatccaggatgaacaa
cacctggtaattgaagttcgcaacaaagatatgagttggcctgaggagatgtcttttata
gcaaatagtagtaaaatagatagacacaaggttcccacagaaaagggagccacaggtcta
agcaacctgggaaacacatgcttcatgaactcaagcatccagtgtgttagtaatacacag
ccactgacacagtattttatctcagggagacatctttatgaactcaacaggacaaatccc
attggtatgaaggggcatatggctaaatgctatggtgatttagtacaggaactttggagt
ggaactcagaagaatgttgccccattaaagcttcggtggaccatagcaaaatatgctccc
aggtttaatgggtttcagcaacaagactcccaagaacttctggcttttctcttggatggt
cttcatgaagatcttaaccgagtccatgaaaagccatatgtggaactgaaggacagtgat
gggcgaccaaactgggaagtagctgcagaggcctgggacaaccatctaagaagaaacaga
tcaattgttgtggatttgttccatgggcagctaagatctcaagtaaaatgcaagacatgt
gggcatataagtgtccgatttgaccctttcaattttttgtctttgccactaccaatggac
agttatatgcacttagaaataacagtgattaggttagatggtactacccctgtacggtat
ggactaagactgaatatggatgaaaagtacacaggtttaaaaaaacagctgagtgatctc
tgtggacttaattcagaacaaatccttctagcagaagtacatggttccaacataaagaac
tttcctcaggacaaccaaaaagtacgactctcagtgagtggatttttgtgtgcatttgaa
attcctgtccctgcgtctccaatttcagcttctagtccaacacagacagatttctcctct
tcgccatctacaaatggaatgttcaccctgactaccaatggggacctaccccgaccaata
ttcatccccaatggaatgccaaacactgttgtgccatgtggaactgagaagaacttcaca
aatggaatggttaatggtcacatgccatctcttcctgacagcccctttacaggttacatc
attgcagtccaccgaaaaatgatgaggacagaactgtatttcctgtcatctcagaagaat
cgccccagcctctttggaatgccattgattgttccatgtactgtgcatacccggaagaaa
gacctatatgatgcggtttggattcaagtatcccggttagcgagcccactcccacctcag
gaagctagtaatcatgcccaggattggtga

DBGET integrated database retrieval system