KEGG   Pongo abelii (Sumatran orangutan): 100438951Help
Entry
100438951         CDS       T01416                                 

Gene name
ARHGEF1
Definition
(RefSeq) rho guanine nucleotide exchange factor 1 isoform X1
  KO
K12330  Rho guanine nucleotide exchange factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04270  Vascular smooth muscle contraction
pon04611  Platelet activation
pon04810  Regulation of actin cytoskeleton
pon04928  Parathyroid hormone synthesis, secretion and action
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100438951 (ARHGEF1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100438951 (ARHGEF1)
  Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100438951 (ARHGEF1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100438951 (ARHGEF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100438951 (ARHGEF1)
   05205 Proteoglycans in cancer
    100438951 (ARHGEF1)
Membrane trafficking [BR:pon04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100438951 (ARHGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS-like RhoGEF PH_13 Syntaxin_2
Motif
Other DBs
NCBI-GeneID: 100438951
NCBI-ProteinID: XP_024092909
Ensembl: ENSPPYG00000010031
Position
19
AA seq 912 aa AA seqDB search
MEDVARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQFQSLEQVKRRPAHLM
ALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPNVAF
ELDRTRADLISEDVQRRFVQEVVQSQQTAVGRQLEDFRSKRLMGMTPWEQELAQLEAWVG
RDRASYEARERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGLYMRHLGVRTKSGDKKS
GRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATD
RKGGLGMPSRDRNVGAPGQDSPGVSLHPLSLDSTDREPGADAPLELGDSSPQGPMSLESL
APPESTDEGAETESPEPGDEGEPGRSGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEV
ISELLVTEAAHVRMLRVLHDLFFQPMAEGLFFPLEELQNIFPSLDELIEVHSLFLDRLMK
RRQESGYLIEEIGDVLLARFDGTEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFV
QEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPKEREKVELAAECCREILH
HVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTK
DKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVAT
DHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASRPKPRPSPSST
REPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEGQLAATALRKVLSLKQLLFP
AEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQ
LGGNSVPQPGCT
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgtcgcccgaggggcggcctccccaggcccctcccggcctggcctggttccc
gtcagcatcattggggctgaggatgaggattttgagaacgagctggagacaaactcagaa
gagcaaaacagccagttccagagcctggagcaggtgaagcggcgcccagcccacctcatg
gccctcctgcagcacgtggccctgcagtttgagccaggacccctgctttgctgtctgcat
gccgacatgctgggctcactgggccccaaggaggccaagaaggccttcctggacttctac
cacagcttcctggagaagacagcggttctgcgggtgccagtccctcccaacgtcgccttt
gaacttgaccgcactagggctgacctcatctccgaagatgtccagcggcggttcgtgcag
gaggtggtgcaaagccagcagacagccgtgggccggcagctggaggacttccgctccaag
cggctcatgggcatgacgccctgggagcaggagctggcccagctggaggcttgggttggg
cgggaccgagccagctacgaggcccgggagcggcacgtggcagagcggctgctcatgcac
ctggaggagatgcaacataccatctctaccgacgaagaaaagagtgctgccgtggtcaac
gccattggcctgtacatgcgccaccttggggtgcgaacgaagagtggagacaagaagtcg
gggaggaacttcttccggaaaaaggtgatggggaaccggcggtcggacgagcctgccaag
accaagaaggggctgagcagcatcctggatgccgcccgctggaaccggggagagccccag
gttccagattttcgacacctcaaagcagaggttgatgctgagaagccaggtgctacagac
cggaagggaggcctggggatgccctctcgggaccggaatgtcggggctcctgggcaggac
agccctggagtctctctgcaccctctgtccctggacagcacagaccgggaaccaggtgcc
gacgcccccctggagctgggggactcatccccgcagggtccaatgagcctggagtccctg
gcgcccccagagagtaccgatgagggggccgaaaccgagagccctgagcctggagatgag
ggggagccagggcggtcgggactggagcttgaaccagaagagcctcccggctggcgggaa
ctcgtccccccagataccctgcacagcctgcccaagagccaggtgaagcggcaggaggtc
atcagcgagttgttggtgacagaggcggcccatgtgcgcatgctgcgggtgctgcacgac
ctcttcttccagcccatggcagaaggcctcttcttccccttggaggagctgcagaacatc
ttccccagcctggacgagctcatcgaggtgcattccctgttcctcgatcgcctgatgaag
cggaggcaggagagtggctacctcatcgaggagatcggagacgtgctgctggcccggttt
gatggtactgagggctcctggttccagaaaatctcctcccgcttctgcagccgccagtcg
tttgccttagagcagctcaaagccaagcaacgcaaggaccctcggttctgtgccttcgtg
caggaagctgagagccgcccgcggtgccgccgcctgcagctgaaggacatgatccccacg
gagatgcagcggctgaccaagtaccccctgctcctgcagagcatcgggcagaacacagaa
gagcccaaggaacgggagaaagtggagctggcagccgagtgctgccgggaaattctacac
cacgtcaaccaagccgtgcgtgacatggaggatctgctgaggctcaaggactatcagcgg
cgcctggacttgtcccaccttcggcagagcagcgaccccatgctgagcgagttcaagaac
ctggacatcaccaagaagaaattggtccacgagggcccactgacgtggcgggtgactaag
gacaaggctgtggaggtgcatgtgctgctgctggacgacctgctgctgctgctccagcgc
caggacgagcggctgctgctcaagtcccatagccggacactgacgcccacgcccgacggc
aagaccatgctgcggcccgtgctgcggctcacctcagccatgacccgcgaggtggccacc
gatcacaaagccttctacgtccttttcacctgggaccaggaggcccagatatacgagctg
gtggcacagactgtgtcggagcggaaaaactggtgtgccctcatcactgagactgccgga
tccctgaaagtccctgcccctgcctctcgccctaagccccggcccagcccgagcagcacc
cgagaacccctcctcagcagctctgagaacggcaatggtggccgagagacgtctccggct
gatgcccggacagagagaatcctcagtgacctcctgcccttctgcagaccaggccccgag
ggccagctcgctgccacggcccttcggaaagtgctgtccctgaagcagcttctgtttccg
gcggaggaagacaatggggcggggcctcctcgagatggggatggggtcccagggggcggc
cccctgagcccagcacggacccaagaaatccaggagaacctgctcagcttggaggagacc
atgaagcagctggaggagttggaggaggaattttgccgcctgagacccctcctgtctcag
cttggggggaactctgtaccccagcctggctgcacttga

DBGET integrated database retrieval system