KEGG   Pongo abelii (Sumatran orangutan): 100438951Help
Entry
100438951         CDS       T01416                                 

Gene name
ARHGEF1
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Vascular smooth muscle contraction
Platelet activation
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100438951 (ARHGEF1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100438951 (ARHGEF1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100438951 (ARHGEF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100438951 (ARHGEF1)
   05205 Proteoglycans in cancer
    100438951 (ARHGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 693 aa AA seqDB search
AKKAFLDFYHSFLEKTAVLRVPVPPNVAFELDRTRADLISEDVQRRFVQEVVQSQQTAVG
RQLEDFRSKRLMGMTPWEQELAQLEAWVGRDRASYEARERHVAERLLMHLEEMQHTISTD
EEKSTVLLSPSFYLTVSPAEKPGATDRKGGLGMPSRDRNVGAPGQDSPGVSLHPLSLDST
DREPGESFLGQGSPAHEVMPPSLHPPQRASCFGGPAELLVTEAAHVRMLRVLHDLFFQPM
AEGLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGTEGS
WFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLT
KYPLLLQSIGQNTEEPKEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSH
LRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLL
LKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVS
ERKNWCALITETAGSLKVPAPASRPKPRPSPSSTREPLSPADARTERILSDLLPFCRPGP
EGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEE
TMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
gccaagaaggccttcctggacttctaccacagcttcctggagaagacagcggttctgcgg
gtgccagtccctcccaacgtcgcctttgaacttgaccgcactagggctgacctcatctcc
gaagatgtccagcggcggttcgtgcaggaggtggtgcaaagccagcagacagccgtgggc
cggcagctggaagacttccgctccaagcggctcatgggcatgacgccctgggagcaggag
ctggcccagctggaggcttgggttgggcgggaccgagccagctacgaggcccgggagcgg
cacgtggcagagcggctgctcatgcacctggaggagatgcaacataccatctctaccgac
gaagaaaagagtactgttctcttatctccctctttctacctcactgtctccccagctgag
aagccaggtgctacagaccggaagggaggcctggggatgccctctcgggaccggaatgtc
ggggctcctgggcaggacagccctggagtctctctgcaccctctgtccctggacagcaca
gaccgggaaccaggtgagagtttcctgggccagggctcccctgcccatgaggtcatgccc
cctagtctgcaccctccccaacgtgcttcctgctttggtggccctgcagagttgttggtg
acagaggcggcccatgtgcgcatgctgcgggtgctgcacgacctcttcttccagcccatg
gcagaaggcctcttcttccccttggaggagctgcagaacatcttccccagcctggacgag
ctcatcgaggtgcattccctgttcctcgatcgcctgatgaagcggaggcaggagagtggc
tacctcatcgaggagatcggagacgtgctgctggcccggtttgatggtactgagggctcc
tggttccagaaaatctcctcccgcttctgcagccgccagtcgtttgccttagagcagctc
aaagccaagcaacgcaaggaccctcggttctgtgccttcgtgcaggaagctgagagccgc
ccgcggtgccgccgcctgcagctgaaggacatgatccccacggagatgcagcggctgacc
aagtaccccctgctcctgcagagcatcgggcagaacacagaagagcccaaggaacgggag
aaagtggagctggcagccgagtgctgccgggaaattctacaccacgtcaaccaagccgtg
cgtgacatggaggatctgctgaggctcaaggactatcagcggcgcctggacttgtcccac
cttcggcagagcagcgaccccatgctgagcgagttcaagaacctggacatcaccaagaag
aaattggtccacgagggcccactgacgtggcgggtgactaaggacaaggctgtggaggtg
catgtgctgctgctggacgacctgctgctgctgctccagcgccaggacgagcggctgctg
ctcaagtcccatagccggacactgacgcccacgcccgacggcaagaccatgctgcggccc
gtgctgcggctcacctcagccatgacccgcgaggtggccaccgatcacaaagccttctac
gtccttttcacctgggaccaggaggcccagatatacgagctggtggcacagactgtgtcg
gagcggaaaaactggtgtgccctcatcactgagactgccggatccctgaaagtccctgcc
cctgcctctcgccctaagccccggcccagcccgagcagcacccgagaacccctctctccg
gctgatgcccggacagagagaatcctcagtgacctcctgcccttctgcagaccaggccct
gagggccagctcgctgccacggcccttcggaaagtgctgtccctgaagcagcttctgttt
ccggcggaggaagacaatggggcggggcctcctcgagatggggatggggtcccagggggc
ggccccctgagcccagcacggacccaagaaatccaggagaacctgctcagcttggaggag
accatgaagcagctggaggagttggaggaggaattttgccgcctgagacccctcctgtct
cagcttggggggaactctgtaccccagcctggctgcacttga

DBGET integrated database retrieval system