KEGG   Pongo abelii (Sumatran orangutan): 100439076Help
Entry
100439076         CDS       T01416                                 

Gene name
CLC
Definition
Charcot-Leyden crystal protein
Orthology
K13334  
eosinophil lysophospholipase (galectin-10) [EC:3.1.1.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100439076 (CLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 139 aa AA seqDB search
MSLLPVPHTQAVSLSTGSTVTIKGKPLVCFFNEPHLQVDFHTEMKEESDIAFHFQVHFGC
YVVMNSREYGAWKKPVESKNMPFQDGQEFELSISVLSDKYQVMVNGQAYYTFDHRIPPEA
VKMVQVWRDISLTKFEVSN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgctacctgtgccacacacacaggctgtgtctttgtctactggttctactgtg
acaatcaaagggaaaccgcttgtctgtttcttcaatgaaccacatctgcaggtggatttc
cacactgagatgaaggaggaatcagacattgccttccatttccaagtgcactttggctgt
tatgtggtcatgaacagccgtgaatatggtgcctggaagaagccggtggaatccaagaac
atgccctttcaggatggccaagaatttgaactgagcatctcagtgctgtcagataagtac
caggtaatggtcaatggccaagcctattacacctttgaccatagaatcccacctgaggct
gtgaagatggtgcaagtgtggagagatatctccctgaccaaatttgaggtcagcaattga

DBGET integrated database retrieval system