KEGG   Pongo abelii (Sumatran orangutan): 100439299Help
Entry
100439299         CDS       T01416                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4
  KO
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
GnRH signaling pathway
Relaxin signaling pathway
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Kaposi's sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Fluid shear stress and atherosclerosis
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100439299
   04012 ErbB signaling pathway
    100439299
   04668 TNF signaling pathway
    100439299
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100439299
   04664 Fc epsilon RI signaling pathway
    100439299
  Endocrine system
   04912 GnRH signaling pathway
    100439299
   04926 Relaxin signaling pathway
    100439299
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100439299
  Infectious diseases
   05166 HTLV-I infection
    100439299
   05164 Influenza A
    100439299
   05161 Hepatitis B
    100439299
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100439299
   05169 Epstein-Barr virus infection
    100439299
   05142 Chagas disease (American trypanosomiasis)
    100439299
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100439299
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100439299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
17
AA seq 222 aa AA seqDB search
MELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILL
DRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITL
YELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPK
YKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggaactcatgtctacctcgtttgacaagttttacaaatatgtatatagtgtattagat
gatgttattccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaac
cacttaaaagaaaacttgaaaattattcacagagatatcaaaccttccaatattcttctg
gacagaagtggaaatattaagctctgtgacttcggcatcagtggacagcttgtggactct
attgccaagacaagagatgctggctgtaggccatacatggcacctgaaagaatagaccca
agcgcatcacgacaaggatatgatgtccgctctgatgtctggagtttggggatcacattg
tatgagttggccacgggccgatttccttatccaaagtggaatagtgtatttgatcaacta
acacaagtcgtgaaaggagatcctccgcagctgagtaattctgaggaaagggaattctcc
ccgagtttcatcaactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaag
tataaagagcttctgaaacatccctttattttgatgtatgaagaacgtgccgttgaggtc
gcatgctatgtttgtaaaatcctggatcaaatgccagctactcccagctctcccatgtat
gtcgattga

DBGET integrated database retrieval system