KEGG   Pongo abelii (Sumatran orangutan): 100439360Help
Entry
100439360         CDS       T01416                                 

Gene name
PPP1R3A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 3A
  KO
K07189  protein phosphatase 1 regulatory subunit 3A/B/C/D/E
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04910  Insulin signaling pathway
pon04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100439360 (PPP1R3A)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100439360 (PPP1R3A)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100439360 (PPP1R3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBM_21 CBM53
Motif
Other DBs
NCBI-GeneID: 100439360
NCBI-ProteinID: XP_002818408
Ensembl: ENSPPYG00000017925
Position
7
AA seq 1139 aa AA seqDB search
MSASTSRTVLSYLISESPMEPSEVSSQISKDNFLEVPNLSDSLCEDEEVTFQPRFSPQPS
RRGSDSSEDIYLDTPSSGTRRVSFADSFGFNLVSVKEFDCWELPSASTTFDLGTDIFHTE
EYVLAPLFDLPSSKEDLMQQLQIQKAILESTESLPGSTSIKGIIRVLNVSFEKLVYVRMS
LDDWQTHYDILAEYVPNSCDGETDQFSFKISLVPPYQKDGSKVEFCIRYETSVGTFWSNN
NGTNYTFICQKKEQEPEPGKPWKEAPNRQIKGCLKVKSSKEESSVTSEENNFENPKNTDT
YIPTIVCSHEDKEDLEACNQNVKDVNREHGEHNEKELELMINQHLIRTRTTASRDERNTF
STDPVNFPNKAEGLEKKQIRGEICTDLFQRSLSPSSSAESSVKGDFYCNEKYSSGNDCAH
QPSEETTSNMGEIKPSLGDTSSYELVQLHTGSKEVLDNNANPAHGNGTMQIPCPSSDQLM
AGNLNKKHEGGAKKIEVKDLGCLRRDFHSDTLACLKESTEEGSSNEDYGNGKNDEEQRIY
LGVNEKQRKNFQTILHDQERKTDNPKISVEGIGASNRDLTTLLSEDTAIPTRAITADMSH
SSRTNLSWEEAVLTPEHHHLTNEGSTLGEITGQVCSSRTGNVLRNDYLFQVEEKSGGINS
ENQDNSPQHKQSWNVLESQGKSRENKTNITEHIKEQTDCEDVWGKRDNTRSLKGTTEELF
TCQETVCCELSSLADHGITEKAEAGAAYIIKTTSESTPESMSAREKAIIAKLPEETARSD
RPIEVKETAFDPHEGRNDDSHYTLCQRDTVGVIYDNDFEKESRLGICNVRVDEMEKEETM
SVYNPRKTHDREKCGTGNTTSVEESSRVITEYQKATSKLDLQLGMLPTDKTVFSENRDHR
QVQELSKKTDLDAIVHSAFNSDTNRAPQNSSPFSKHHTEISVSTNEQAIAVENAVATMAS
QPTSTKSENIYNSTREIQGIEKHPYSESKPEEVSRSSGIVTSGSRKERCIGQIFQTEECS
VEKSLGPMILISKPLENMEEARHENEGLVNSGQSLYSSGEKQSESSASTSLRVEESQAQG
NESLFSKYTNSKIPYFLLFLIFLLTVYHYDLMIGLAFYLLSLSWLSWEEGRQKESVKKK
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcctctactagtcgtacagttctctcttatttgatatcagagagcccaatggag
ccttctgaagtatctagtcagattagcaaagataattttttagaagttcctaatttatct
gactctctttgtgaagatgaagaagttactttccaacctcgtttctcccctcaaccaagt
agacgaggttctgattcttctgaagacatatacctggataccccatcttcaggtactaga
agagtttcatttgctgattcctttggattcaatcttgtgtctgttaaagaatttgattgc
tgggaattaccaagtgcttcaaccacttttgacttagggacggacattttccacacagaa
gaatatgttttagccccactgtttgacttgccttcttcaaaagaagatcttatgcaacaa
ctccaaatacagaaagcaatactggagtcaactgagtctcttcctgggtctacaagtatc
aagggtattattcgagttttgaatgtttcttttgagaagttagtatatgtaagaatgtct
ttagatgactggcagacacattatgacattttggcagaatatgttcctaattcatgtgat
ggtgaaactgaccagttctcttttaagatttcattggttcctccttatcaaaaagatggc
agtaaagttgagttttgtatacgttatgaaacttctgttggtacattttggtcaaataat
aatggcacaaattatacattcatttgtcaaaagaaagaacaagagccggagcctggaaaa
ccatggaaagaagctcctaaccgacaaataaaaggctgcttaaaggtaaaatcaagtaaa
gaagaatcatcagtaacatcagaagaaaataactttgagaatccaaagaatacagatacc
tatatcccaacaattgtttgttctcatgaggacaaggaagatttggaagcctgtaatcaa
aatgtaaaagatgtaaacagggaacatggtgaacataatgaaaaagaattagagttgatg
ataaatcaacacttaataagaaccagaactactgcttccagagatgaaaggaatacattt
tcaacagatccagtcaattttccaaataaagcagaggggttagagaagaagcaaatccgt
ggtgaaatatgtactgacttgttccaaaggtctctgtctccaagttcatcagcagaaagc
tctgtaaagggagatttttactgcaatgaaaaatattcctcaggaaatgactgtgcgcat
caaccttcagaggaaactacttcaaatatgggagaaatcaagccatcattgggagatact
agtagttatgaactagtgcaactacacactggcagcaaagaagtcctggataataatgct
aatccagcccatggcaatggcacaatgcaaataccttgcccctcttcagatcaactaatg
gcaggaaaccttaataaaaaacatgaaggaggagctaaaaaaattgaagtaaaagatttg
ggatgtttacgaagagatttccattcagatacgttggcatgtctcaaagaatcaacagaa
gaaggatcttctaatgaagattatggcaatggtaagaatgatgaagaacaaagaatatat
ttaggtgttaatgaaaaacaaagaaaaaatttccaaacaatcttacatgaccaagaaagg
aagacggacaaccctaaaataagtgtggaagggattggagctagtaacagagacctgact
acgctgctgagcgaagataccgcaatccccacccgggcaatcacagcagacatgtctcat
tcatcaaggacaaatttaagttgggaagaagctgtgttaaccccagagcatcatcatttg
accaatgaaggcagcactttaggagagataactggtcaagtttgttcatcaagaactgga
aatgttttgaggaatgattatcttttccaagttgaagaaaaatcaggtgggattaattct
gaaaatcaggataatagcccacagcataaacaaagttggaatgttctggaaagtcaggga
aaatcaagagagaataagacaaacataacagagcatatcaaagaacaaacagattgtgaa
gacgtgtggggaaaaagagataatacgaggagtttgaaaggtactacagaagaattgttt
acctgccaagaaacagtgtgctgtgaactgtcttctctagctgatcatggtattactgag
aaagcagaagctggtgcagcctatataattaagacaacatcagaaagtactccagaaagc
atgtctgctagagaaaaagcaataattgctaagctacctgaagagacagcacgaagtgac
aggcccatcgaggtaaaggaaacagcgtttgatccacatgaagggagaaatgatgattca
cattatactctttgtcaacgagatacagtaggtgtaatctatgacaatgattttgaaaag
gaatcacgtttaggtatttgtaatgtacgtgtagatgaaatggagaaggaagaaaccatg
tctgtgtacaatcctaggaagacacatgacagggagaaatgtggcactggaaatacaaca
tctgtggaagaatcctcacgggtcattacagaatatcaaaaagcaacttcaaaactggat
ttacagttgggaatgttgccaacagacaaaacggtattttcagaaaacagagatcatagg
caggttcaagaattatcaaagaaaacagatttggatgccattgtgcattctgcttttaac
tcagacactaatagagctcctcagaatagctctcctttttccaaacatcatactgaaatt
tcagtgtcaactaatgagcaggcaattgctgtagagaatgcagttgctaccatggctagc
caacctacttctacgaaatcagaaaatatttataattcaacaagagaaatccagggtatt
gagaagcacccttattctgagtctaaacctgaagaagtttccagaagttcaggaatagtg
acatcaggtagtagaaaagaaagatgcataggccagattttccaaacagaagaatgtagt
gtggaaaaatctctagggccaatgattttaatcagcaaacctcttgagaatatggaagaa
gcaaggcatgaaaatgaaggattagtaaactctgggcaatcactatactcttcaggtgaa
aagcaatctgagagctctgcatctactagtcttcgtgtggaggaaagtcaagctcaaggc
aatgaatctttgttttcaaaatataccaactctaaaataccttatttccttttgtttctg
atatttcttctaactgtctaccattatgacttaatgattggcttggcattctaccttttg
tcattgtcctggctatcctgggaagagggtagacaaaaagagtctgtcaaaaagaagtaa

DBGET integrated database retrieval system