KEGG   Pongo abelii (Sumatran orangutan): 100439777Help
Entry
100439777         CDS       T01416                                 

Definition
(RefSeq) aromatase
  KO
K07434  aromatase [EC:1.14.14.14]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00140  Steroid hormone biosynthesis
pon01100  Metabolic pathways
pon04913  Ovarian steroidogenesis
Module
pon_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100439777
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100439777
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     100439777
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP19 family
   100439777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 DUF5432
Motif
Other DBs
NCBI-GeneID: 100439777
NCBI-ProteinID: XP_002825496
Ensembl: ENSPPYG00000006475
UniProt: H2NN83
Position
15
AA seq 503 aa AA seqDB search
MVLEMLNPMHYNITSIVPEAMPAATMPILLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPDLWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNMLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIMKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttttggaaatgctgaacccaatgcattataacatcaccagcatcgtgcctgaagcc
atgcctgctgccaccatgccaatcctgctcctcactggcctttttctcttggtgtggaat
tatgagggcacatcctcaataccaggtcctggctactgcatgggaattggacccctcatc
tcccatggcagattcctgtggatggggatcggcagtgcctgcaactactacaaccgggtg
tatggagaattcatgcgagtctggatctctggagaggaaacactcattatcagcaagtcc
tcaagtatgttccacataatgaagcacaatcattacagctctcgattcggcagcaaactt
gggctgcagtgcatcggtatgcatgagaaaggcatcatatttaacaacaatccagatctc
tggaaaacaactcgacccttctttatgaaagctctgtcgggccctggccttgttcgcatg
gtcacagtctgtgctgaatccctcaaaacacatctggacaggttggaggaggtgaccaat
gaatcaggctacgtggacgtgttgacccttctgcgtcgtgtcatgctggacacctctaac
atgctcttcttgaggatccctttggacgaaagtgctatcgtggttaaaatccaaggttat
tttgatgcatggcaagctctcctcatcaaaccagacatcttctttaagatttcttggcta
tacaaaaagtatgagaagtctgtcaaggatttgaaagatgccatagaagttctgatagca
gaaaaaagacgcaggatttccacagaagagaaactggaagaatgtatggactttgccact
gagttgattttagcggagaaacgtggtgacctgacaagagagaatgtgaaccagtgcata
ttggaaatgctgattgcagctcctgacaccatgtctgtctctttgttcttcatgctattt
ctcattgcaaagcaccctaatgttgaagaggcaataatgaaggaaatccagactgttatt
ggtgagagagacataaagattgatgatatacaaaaattaaaagtgatggaaaacttcatt
tatgagagcatgcggtaccaacctgttgtggacttggtcatgcgcaaagccttagaagat
gatgtaatcgatggctacccagtgaaaaaggggacgaacattatcctgaatattggaagg
atgcacagactcgagttttttcccaaacccaatgaatttactcttgaaaattttgcaaag
aatgttccttataggtactttcagccatttggctttgggccccgtggctgtgcaggaaag
tacatcgccatggtgatgatgaaagccatcctcgttacacttctgagacgattccacgtg
aagacattgcaaggacagtgtgttgagagcatacagaagatacacgacttgtccttgcac
ccagatgagactaaaaacatgctggaaatgatctttaccccaagaaactcagacaggtgt
ctggaacactag

DBGET integrated database retrieval system