KEGG   Pongo abelii (Sumatran orangutan): 100439815Help
Entry
100439815         CDS       T01416                                 

Definition
serine/threonine-protein kinase PAK 2-like
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:pon04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:pon04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:pon04012]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:pon04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:pon04510]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:pon04660]
Organismal Systems; Development; Axon guidance [PATH:pon04360]
Human Diseases; Cancers; Renal cell carcinoma [PATH:pon05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 260 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSNVDGGAKSLDKQKKKTKMTDEEIMEKLSMLS
TFYIIVKLLTALKTFGPDEF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcacctcctgtgcgaatgagcagc
accatctttagcactggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccttctgttccagaagagaaaaagcccaggcataaaatcatctctatattctcaggcaca
gagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gagcacaccatccatgttggctttgatgctgtcactggagaattcactggtatgccagaa
cagtgggctcgattactacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcctaaagttctacgactccaacacagtgaagcagaaatatctg
agctttactcctcctgagaaagatggctttccttctggaacaccagcactgaatgccaag
ggaacagaagcacctgcagtagtgacagaggaggaggatgatgatgaagagactgctcct
cccgttattgccccgcgaccggatcacacgaaatcaatttacacacggtctgtaattgac
cctgttcctgcaccagttggtgattcaaatgttgatggtggtgccaagtctttagacaaa
cagaaaaagaagactaagatgacagatgaagagattatggagaaattaagtatgttatct
acattttacatcattgttaaattgttaacagctcttaaaacatttggcccagacgaattt
taa

DBGET integrated database retrieval system