KEGG   Pongo abelii (Sumatran orangutan): 100439815Help
Entry
100439815         CDS       T01416                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 2-like
  KO
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100439815
   04010 MAPK signaling pathway
    100439815
   04012 ErbB signaling pathway
    100439815
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100439815
  Cell motility
   04810 Regulation of actin cytoskeleton
    100439815
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100439815
  Development
   04360 Axon guidance
    100439815
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    100439815
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100439815
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   100439815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 260 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSNVDGGAKSLDKQKKKTKMTDEEIMEKLSMLS
TFYIIVKLLTALKTFGPDEF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcacctcctgtgcgaatgagcagc
accatctttagcactggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccctctgttccagaagagaaaaagcccaggcataaaatcatctctatattctcaggcaca
gagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gagcacaccatccatgttggctttgatgctgtcactggagaattcactggtatgccagaa
cagtgggctcgattactacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcctaaagttctacgactccaacacagtgaagcagaaatatctg
agctttactcctcctgagaaagatggctttccttctggaacaccagcactgaatgccaag
ggaacagaagcacctgcagtagtgacagaggaggaggatgatgatgaagagactgctcct
cccgttattgccccgcgaccggatcacacgaaatcaatttacacacggtctgtaattgac
cctgttcctgcaccagttggtgattcaaatgttgatggtggtgccaagtctttagacaaa
cagaaaaagaagactaagatgacagatgaagagattatggagaaattaagtatgttatct
acattttacatcattgttaaattgttaacagctcttaaaacatttggcccagacgaattt
taa

DBGET integrated database retrieval system