KEGG   Pongo abelii (Sumatran orangutan): 100440111Help
Entry
100440111         CDS       T01416                                 

Gene name
MAPK15
Definition
mitogen-activated protein kinase 15
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100440111 (MAPK15)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100440111 (MAPK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 544 aa AA seqDB search
MCTAVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFRE
ITLLQEFGDHPNLIGLLDVIRAENDRDITWXXXXADTDLNAVIRKGGLLQDIHVRSIFYQ
LLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQALTEYVXT
RWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEE
DLLALGSGCRAPVLHHLGSRPRQTLDALLPPDTSPEALDLLRQLLVFAPDKRLSATQALQ
HPYVQRFHCPSDEWARKADVRLRAHEGVQLAAPEYRSRVYQMILERGGSSGTSRKKGPER
VSRSQAHVHKPRADPQLPSGTRVQGPRPRPQSSLGHDPPEHESPCAAKNIPRQNSAPLLQ
TALLGNGERPLGRRXSAPLTLSLVKPSGRGAAPSLTSQAAAQVANQVLIRGDWNRGGGVR
VASTQQVPPRLPPEARPGRRMFSTSALQGAQGAARALLGGYSQAYGTVCHSALGHLPLLE
GHRV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaccgcagtggaccctcgcatcgtccggagatacctactcaggcggcagctcggg
cagggggcctatggcattgtgtggaaggcagtggaccggaggactggtgaggtcgtggcc
atcaagaaaatctttgatgcttttagggataagacagatgcccagagaacattccgggaa
atcacgctcctccaggagtttggggaccatcccaacttaattggcctccttgacgtgatc
cgggcagagaacgacagggacattacctggnnnnnnnnnnccgcagacactgacctgaac
gcagtcatccggaagggcgggctgctgcaggacatccacgtgcgctccatcttctaccag
ctcctgcgggccacccggttcctccactccgggcacgttgtgcaccgggaccagaagccg
tccaatgtgctcctggatgccaactgcacagtgaagctgtgtgactttggcctggcccgc
tccctgggcgacctccccgaggggcctgaggaccaggccttgacagagtacgtgngcaca
cgctggtaccgagctccggaggtgttgctctcttcgcaccgatacacccttggggtggac
atgtggagtctgggctgtatcctgggggagatgctgcgagggaggcccctgttcccgggt
acgtccaccctccaccagctggagctgatcctggagaccatcccgccaccatccgaggag
gacctcctggctctcggttcaggctgccgtgcccctgtgctgcaccacctggggtcccgg
ccacgacagacgctggatgccctcctaccgccagacacctccccagaggcgttggacctc
cttaggcaactcctggtgttcgccccggacaagcggttaagcgcgacccaggcactgcag
cacccctacgtgcagaggttccactgccccagtgacgagtgggcacgaaaggcagatgtg
cggctccgggcacacgaaggggtccagctcgctgcacctgagtaccgcagccgcgtctat
cagatgatcctggagcgtggaggcagcagcggcacctcgagaaagaagggcccggagcgt
gtctcccggagccaggcacacgtgcacaaacccagagccgaccctcagctgccttctggg
acacgtgtgcagggtcccagacccaggcctcagagtagcctgggccacgacccccccgag
cacgagtccccctgtgcagccaagaacattcccaggcagaactccgctcccctgctccaa
actgcactcctagggaatggggaaaggcccctggggcgaaggnnaagcgcccccttgaca
ctctcgctggtgaagccaagcggcaggggagctgcgccctccctgacctcccaggctgcg
gctcaggtggccaaccaggtcctgatccggggtgactggaaccggggcggtggggtgagg
gtggccagcacacaacaggtccctccccggcttcctccggaggcccggcccggccggagg
atgttcagcacctctgccttgcagggtgcccagggggctgccagggctttgcttggaggc
tactcccaagcctacgggactgtgtgccactcggcactgggccacctgcccctgctggag
gggcaccgtgtgtga

DBGET integrated database retrieval system