KEGG   Pongo abelii (Sumatran orangutan): 100440562Help
Entry
100440562         CDS       T01416                                 

Gene name
USP26
Definition
ubiquitin specific peptidase 26
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100440562 (USP26)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100440562 (USP26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 915 aa AA seqDB search
MAALFLRGFVQIGNCKTGMSKSKEAFIEAVEGEKKDRLVLYFKSGKYNTFQLSDNIQNVV
LRSYRGNQNYLHLTLQNNNVLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFS
STTTQKEINKTSFHKVDEKSSSKSFEIAKGSGTGVLQRMPLLTSKSSTLTCGELSENQHE
KRKRMLSSSSEMNEEFLKENNSVEYKKSKADRSRCVSYNREKRLKLKELEENKKLECESS
CIMNATGNPYLDDIGLLQALTEKMVLAFLLQPGYSDGYTKWDKLKLFFELFPEKICHGLP
NLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLAWLLFFKDTYNIEIKE
MLLLNLKKAISAVAEIFHGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPK
QVFADDPDTNGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAHPSS
IQSTFDLFFGAEELEYTCAKCKHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKDDQE
VIISKYLKVSSHCNEGTRPPLPLSEDGEITDFQLLKVIRKMTSGSISISWPSTKESKDIL
ASHIGSDKESELKKGQAVFKGTSRRQQQKYLGKNSKPNEPESVYSGDRAFIEKEPLAHLM
AYLEDTSLCQFHKAGGKPASSPGTRLAEVHFQTVPENPKRKKYVKTSKFVAFDRIINPTK
DLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPRSFPKPGAQGHTKNLLRPTKL
NLQKSNRNFLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLK
SGHYICDAYDFEKQIWFTYNDMQVLGIQEAQMQEDRRCTGYIFFYVHNEIFEEMLKREEN
AQLNSKEVEETLLKK
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctattcctacgtggttttgtccaaatagggaactgcaagactgggatgtct
aagtcaaaagaagcattcattgaagcagtggaaggagagaagaaagatagactggtgctg
tatttcaaaagtggaaaatataacacttttcagctaagtgataatattcaaaatgtagtc
cttagatcctatagaggaaaccaaaattacctgcatttaactttacaaaataataatgtc
ttgtttattgaaggattatcctccacagatgctgaacaattgaagatattcttggacaga
gttcatcaaaacgaggttcagccacctgtgagacctggtaagggtgggagtgtcttttct
agcacaacaacacagaaggaaatcaacaaaacttcattccacaaagttgatgagaaatca
agtagcaaatcttttgagatagcaaaaggaagtgggacaggtgtccttcagaggatgcct
ttgcttacatcaaaatcatcaacacttacttgcggagagttatcagaaaatcagcacgag
aagaggaaaagaatgctctcatctagctcagagatgaatgaggaattcttgaaagaaaat
aattctgtagaatacaagaaatccaaggcagatcgttcgaggtgtgtaagctataataga
gagaaacgattgaagttaaaagagttagaagagaataagaaattggaatgtgaatcttca
tgcatcatgaacgctactggaaatccttacctagatgacattggacttctccaagctctc
actgagaaaatggttttggcatttctgttacaaccagggtatagtgatggttacacaaag
tgggataaattaaaactattttttgaattatttccagagaaaatatgccacggcctcccc
aatttgggaaacacctgttatatgaatgcagtgttacagtctctactttcaatcccatcg
tttgctgatgatttacttaatcagagtttcccatggggtaaaattccccttaatgctctt
accatgtgcttggcgtggctacttttttttaaagatacctataatatagaaatcaaggag
atgttactcttgaatcttaaaaaggccatttcagcagttgcagagatattccatggcaat
gcacagaacgatgctcatgagtttttagctcactgtttagatcagctgaaagataacatg
gaaaaactcaacacaatttggaagcctaaaagtgaatttggggaagataattttcctaaa
caggtttttgctgatgatcctgacaccaatgggttttcttgccctgtcattactaatttt
gagttagagttgttgcactccattgcttgtaaagcttgtggtcaggttattctcaagaca
gaactgaataattacctctccatcaaccttccccaaagaataaaagcacatccttcatct
attcagtctacttttgatcttttttttggagcagaagagcttgagtatacatgtgcaaaa
tgtaagcacaagacttctgttggagtgcactcattcagtaggctacctagaatccttatt
gttcacctcaaacgctatagcttgaatgagttttgtgcattaaagaaggatgaccaggaa
gtcatcatttccaaatatttaaaggtgtcttctcattgcaatgaaggcaccagaccacct
cttcccttgagtgaggatggagaaattacagatttccaattattaaaagttattcgaaag
atgacttctggaagcatcagcatatcatggccttcaacaaaggaatccaaagatatcctg
gcttcacacattggatcagataaggagtctgaactaaaaaaaggccaggcagtctttaaa
gggacaagcagaagacagcagcaaaagtaccttggaaaaaattctaaaccaaatgagcca
gaatctgtatactcaggagatcgagcattcattgaaaaagaaccattagctcacttaatg
gcatatctggaagatacctcactttgtcagttccacaaagctggaggtaaacctgccagc
agcccaggcacacgtctcgcagaagttcactttcaaacagtgcccgaaaatccaaaacga
aagaaatatgtgaaaaccagtaagtttgtagcttttgataggattatcaatcctactaaa
gatttgtatgaagataaaaatatcagaattccagaaagattccaaaaagtgtctgaacag
actcagcagtgtgacggtatgagaatctgtgaacaagcccctcagcaggcactgcctcga
agctttccaaagccaggtgcccaggggcacacaaagaatctcctaagacctacaaaatta
aatctccagaagtctaacaggaatttcctacttgcattgggttccaataagaacccaaga
aacaaagacattttagataagataaaatctaaagccaaggaaacaaaaagaaatgatgat
aagggagatcatacctaccggctcattagtgttgtcagccatcttgggaagactctaaag
tcaggccattatatctgtgatgcctatgactttgagaaacagatctggttcacttacaat
gatatgcaggtgttaggtatccaggaggcccagatgcaggaggataggcgttgcactggg
tacatcttcttttacgtgcataatgagatctttgaagagatgttgaaaagagaagagaat
gcccagcttaatagcaaggaggtagaggagacccttctgaagaaataa

DBGET integrated database retrieval system