KEGG   Pongo abelii (Sumatran orangutan): 100440770Help
Entry
100440770         CDS       T01416                                 

Gene name
ALPL
Definition
alkaline phosphatase, liver/bone/kidney
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100440770 (ALPL)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100440770 (ALPL)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100440770 (ALPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 558 aa AA seqDB search
MEHQLTSDHCQPTPSHPSRSHLWAPGIKQVLGCTMISPFLVLAIGTCLTNSLVPEKEKDP
KYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETR
LEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCNTTQGNE
VTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAY
QLMHNIRDIDVIMGGGRKYMYPKNKTDVEYEIDEKARGTRLDGLDLVDTWKSFKPRHKHS
HFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKG
FFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFG
GYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSA
VPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYIPHVMAYAACIGANLDHCASASSAGSL
AAGPLLLALALFPLSVLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcagttaacatctgaccactgccagcccaccccctcccacccaagtcgatcg
catctctgggctccagggataaagcaggtcttggggtgcaccatgatttcaccattctta
gtactggccattggcacctgccttaccaactccttagtgccagagaaagagaaagacccc
aagtactggcgagaccaagcgcaagagacactgaaatatgccctggagcttcagaagctc
aataccaacgtggctaagaatgtgatcatgttcctgggagatgggatgggcgtctccaca
gtgacggccgcccgcatcctcaagggtcagctccaccacaaccctggggaggagaccagg
ctggagatggacaagttccccttcgtggccctctccaagacgtacaacaccaatgcccag
gtccctgacagcgccggcaccgccaccgcctacctgtgtggggtgaaggccaacgagggc
actgtgggggtaagcgcggccactgagcgttcccggtgcaacaccacccaggggaacgag
gtcacctccatcctgcgctgggccaaggacgctgggaaatctgtgggcattgtgaccacc
acgagagtgaaccatgccacccccagcgccgcctacgcccactcggctgaccgggactgg
tactcagacaacgagatgccccctgaggccttgagccagggctgcaaggacatcgcctac
cagctcatgcataacatcagggacattgacgtgatcatggggggtggccggaaatacatg
taccccaagaataaaactgatgtggagtatgagattgacgagaaagccaggggcacgagg
ctggacggcctggacctcgttgacacctggaagagcttcaaaccgagacacaagcactcc
cacttcatctggaaccgcacggaactcctgacccttgacccccacaatgtggactaccta
ttgggtctcttcgagccgggggacatgcagtacgagctgaacaggaacaacgtgacggac
ccgtcactctctgagatggtggtggtggccatccagatcctgcggaagaaccccaaaggc
ttcttcttgctggtggaaggaggcaggattgaccatgggcaccatgaaggcaaagccaag
caggccctgcacgaggcggtggagatggaccgggccatcgggcaggcaggcagcttgacc
tcctcggaagacactctgaccgtggtcactgcggaccattcccacgtcttcaccttcggt
ggatacaccccccgtggcaactctatctttggtctggcccccatgctgagtgacacagac
aagaagcccttcactgccatcctgtacggcaatgggcctggctacaaggtggtgggcggt
gagcgagagaatgtctccatggtggactacgctcacaacaactaccaggcacagtctgct
gtgcccctgcgccacgagacccacggcggggaggacgtggccgtcttctccaagggcccc
atggcgcacctgctgcacggcgtccatgagcagaactacatcccccacgtgatggcgtat
gcagcctgcatcggggccaacctcgaccactgtgcctctgccagctcggcaggcagcctt
gctgcaggccccctgctgctcgcgctggccctcttccccctgagcgtcctgttctga

DBGET integrated database retrieval system