KEGG   Pongo abelii (Sumatran orangutan): 100440860Help
Entry
100440860         CDS       T01416                                 

Gene name
USP47
Definition
ubiquitin specific peptidase 47
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100440860 (USP47)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100440860 (USP47)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 1287 aa AA seqDB search
MVPGEENQLVPKEAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGEQPQILLEDSSAGEDS
VHDRFIGPLPREGSVGSTSDYVSQSYSYSSILNKSETGYVGLVNQAMTCYLNSLLQTLFM
TPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAW
QQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIP
LVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTL
QLKRFDFDYTTMHRIKLNDRMTFPEELDMSTFIDVEDEKSPQTESCTDSGAENEGSCHSD
QMSNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELFSVMVHSGSAAGGHYYACI
KSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLIYRLKDPAR
NAKFLEVDEYPEHIKNLVQKERELEEQEKRQREIERNTCKIKLFCLHPTKQVMMENKLEV
HKDKTLKEAVEMAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVK
STYMFDLLLETKKPDQVFQSYKPGEVMVKVHVVDLKAESVAAPITVRAYLNQTVTEFKQL
ISKAIHLPAETMRIVLERCYNDLRLLNVSSKTLKAEGFFRSNKVFVESSETLDYQMAFAD
SHLWKLLDRHANTIRLFVLLPEQSPGSYSKRTAYQKAGGDSGNVDDDCERVKGPVGSLKS
VEAILEESTEKLKSLSLQQQQDGDNGDSSKSTETSDFENIESPLNERDSSASVDNRELEQ
HIQTSDPENFQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNADNAQIPLANGLDSH
SITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEPYAADEGSGEG
HKWLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYASNQEFESVRLNETLSSFSDDN
KITIRLGRALKKGEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELIPQLREQCG
LELSIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEVLDGVEKMKSMSQLAVL
SRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDI
HHDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGH
RVTYSPRKEKALKIYLDGAPNKDLTQD
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccggcgaggagaaccaactggtcccgaaagaggcaccactggatcataccagt
gacaagtcacttcttgatgctaattttgagccaggaaagaagaactttctgcatttgaca
gataaagatggtgaacaacctcaaatactgctggaggattccagtgctggggaagacagt
gttcatgacaggtttataggtccacttccaagagaaggttctgtgggttctaccagtgat
tacgtcagccaaagctactcctactcatctattttgaataaatcagaaactggatatgtg
ggactagtaaaccaagcaatgacgtgctatttgaatagccttttgcaaacactttttatg
actcctgaatttaggaatgcattatataagtgggaatttgaagaatctgaagaagatcca
gtgacaagtattccataccaacttcaaaggctttttgttttgttacaaaccagcaaaaag
agagcaattgaaaccacagatgttacaaggagctttggatgggatagtagtgaggcttgg
cagcagcatgatgtacaagaactatgcagagtcatgtttgatgctttggaacagaaatgg
aagcaaacagaacaggctgatcttataaatgagctatatcaaggcaagctgaaggactac
gtgagatgtctggaatgtggttatgagggttggcgaatcgacacatatcttgatattccg
ttggtcatccgaccttatgggtccagccaagcatttgctagtgtggaagaagcattgcat
gcatttattcagccagagattctggatggcccaaatcagtatttttgtgaacgttgtaag
aagaagtgtgatgcacggaagggccttcggtttttgcattttccttatctgctgacctta
cagctgaaaagattcgattttgattatacaaccatgcataggattaaactgaatgatcga
atgacatttcccgaggaactagatatgagtacatttattgatgttgaagatgagaaatct
cctcagactgaaagttgcactgacagtggagcagaaaatgaaggtagttgtcacagtgat
cagatgagcaacgatttctccaatgatgatggtgttgatgaaggaatctgccttgaaacc
aatagtggaactgaaaagatctcaaaatctggacttgaaaagaattccttgatctatgaa
cttttctctgttatggttcattctgggagcgctgctggtggtcattattatgcatgtata
aagtcattcagtgatgagcagtggtacagcttcaatgatcaacatgtcagcaggataaca
caagaggacattaagaaaacacatggtggatcttcaggaagcagaggatattattccagt
gctttcgcaagttccacaaatgcatatatgctgatctatagactgaaggatccagccaga
aatgcaaaatttctagaagtggatgaatacccagaacatattaaaaacttggtgcagaaa
gagagagagttggaagaacaagaaaagagacaacgagaaattgagcgcaatacatgcaag
ataaaattattctgtttgcatcctacaaaacaagtaatgatggaaaataaattggaggtt
cataaggataagacattaaaggaagcagtagaaatggcttataagatgatggatttagaa
gaggtaatacccctggattgctgtcgccttgttaaatatgatgagtttcatgattatcta
gaacggtcatatgaaggagaagaagatacaccaatggggcttctactaggtggcgtcaag
tcaacatatatgtttgatctgctgttggagacgaaaaagcctgatcaggttttccaatct
tataaacctggagaagtgatggtgaaagttcatgttgttgatctaaaggcagaatctgta
gctgctcctataactgttcgtgcttacttaaatcagacagttacagagttcaaacaactg
atttcaaaggccatccatttacctgctgaaacaatgagaatagtgctggaacgctgctat
aatgatttacgtcttctcaatgtctccagtaaaaccctgaaagctgaaggattttttaga
agtaacaaggtgtttgttgaaagctccgagactttggattaccagatggcctttgcagac
tctcatttatggaaactcctggatcggcatgcaaatacaatcagattatttgttttgcta
cctgaacaatccccaggatcttattccaaaaggacagcataccagaaagctggaggcgat
tctggtaatgtggatgatgattgtgaaagagtcaaaggacctgtaggaagcctaaagtct
gtggaagctattctagaagaaagcactgaaaaactcaaaagcttgtcactgcagcaacag
caggatggagataatggggacagcagcaaaagtactgagacaagtgactttgaaaacatc
gaatcacctctcaatgagagggactcttcagcatcggtggataatagagaacttgaacag
catattcagacttctgatccagaaaattttcagtctgaagaacgatcagactcagatgtg
aataatgacaggagtacaagttcagtggacagtgatattcttagctccagtcatagcagt
gatactttgtgcaatgcagacaatgctcagatccctttggctaatggacttgactctcac
agtatcacaagtagtagaagaacgaaagcaaatgaagggaaaaaagaaacatgggataca
gcagaagaagattctggaactgatagtgaatatgatgagagtggcaagagtaggggagaa
atgcagtacatgtatttcaaagctgaaccctatgctgcagatgaaggttctggggaagga
cataaatggttgatggtgcatgttgataaaagaattactctggcagctttcaaacaacat
ttagagccctttgttggagttttgtcctctcacttcaaggtctttcgagtgtatgccagc
aatcaagagtttgagagcgtccggctgaatgagacactttcatcattttctgatgacaat
aagattacaattagactggggagagcacttaaaaaaggagaatacagagttaaagtatac
cagcttttggtcaatgaacaagagccatgcaagtttctgctagatgctgtgtttgctaaa
ggaatgactgtacggcaatcaaaagaggaattaattcctcagctcagggagcaatgtggt
ttagagctcagtattgacaggtttcgtctaaggaaaaaaacatggaagaatcctggcact
gtgtttttggattatcatatttatgaagaagatattaatatttccagcaactgggaggtt
ttccttgaagttcttgatggggtagagaagatgaagtccatgtcacagcttgcagttttg
tcaagacggtggaagccgtcagagatgaagttggatcccttccaggaggttgtattggaa
agcagtagtgttgacgaattgcgagagaagcttagtgaaatcagtgggattcctttggat
gatattgaatttgctaagggtagaggaacatttccctgtgatatttctgtccttgatatt
catcacgatttagactggaatcccaaagtttctaccctgaatgtctggcctctttatatc
tgtgatgatggtgcggtcatattttatagggataaaacagaagaattaatggaattgaca
gatgaacaaagaaatgaactgatgaaaaaagaaagcagtcgactccagaagactggacat
cgtgtaacatactcacctcgtaaagagaaagcactaaaaatatatctggatggagcacca
aataaagatctgactcaagactga

DBGET integrated database retrieval system