KEGG   Pongo abelii (Sumatran orangutan): 100441314Help
Entry
100441314         CDS       T01416                                 

Gene name
TTK
Definition
TTK protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Cell cycle
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:pon04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 865 aa AA seqDB search
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKNLSASTVLTAQESFSSSLGHLQNRNNSCDSRGQTTKARF
LYGENMPPQDAEIGYRNSLRQTNKTKSGKFLSICLIKSCPFGRVPVNLLSSPDCDVKTDD
SVVPCFIKRQTSRSECRDLVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELIIT
DSITLKNKTESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPE
LARKVNTEQKHTTFEQPVFSVSKQSPPISASKWFDPKSICKTPSSNTLDDYMSCFRTPVV
KNDFPPACQLSTPYGQPACFQQQQQQILATPLQNLQVLASSSANECISVKGRIYSILKQI
GSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDY
EITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPA
NFLIVDGMLKLIDFGIANQMQPDTTSIVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKI
SPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCC
LKRDPKQRISIPELLAHPYVQIQTHPGNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKT
LYEHYSGGESHNSSSKTFEKKREKK
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgaggatttaagtggcagagaattgacaattgattccataatgaacaaagtg
agagacattaaaaataagtttaaaaatgaagaccttactgatgaactaagcttgaataaa
atttctgctgatactacagataactcgggaactgttaaccaaattatgatgatggcaaac
aacccagaggactggttgagtttgttgctcaaactggagaaaaacagtgttccgctaagt
gatgctcttttaaataaattgattggtcgttacagtcaagcaattgaagcgcttccccca
gataaatatggccaaaatgagagttttgctagaattcaagtgagatttgctgaattaaaa
gctattcaagagccagatgatgcacgtgactactttcaaatggccagagcaaactgcaag
aaatttgcttttgttcatatctcttttgcacaatttgaactgtcacaaggtaatgtcaaa
aaaagtaaacaacttcttcaaaaagctgtagaacgtggagcagtaccactagaaatgctg
gaaattgccctacggaatttaaacctccaaaaaaagcagctgctttcagaggaggaaaag
aagaatttatcagcatctacggtattaactgcccaagaatcattttccagttcacttggg
catttacagaataggaacaacagttgtgattccagaggacagactactaaagccaggttt
ttatatggagagaacatgccaccacaagatgcagaaataggttatcggaattcattgaga
caaactaacaaaactaaatcaggtaagttcctttcaatctgcttgattaagtcatgccca
tttggaagagtcccagttaaccttctaagtagcccagattgtgatgtgaagacagatgat
tcagttgtaccttgttttataaaaagacaaacctctagatcagaatgccgagatttggtg
cccggatctaaaccaagtggaaatgattcctgtgaattgagaaatttaaagtccgttcag
aatagccatttcaaggaacctctggtgtcagatgaaaagagttctgaacttattattact
gattcaataaccctgaagaataaaactgaatcaagtcttctagctaaattagaagaaact
aaagagtatcaagaaccagaggttccagagagtaaccagaaacagtggcaatctaagaga
aagtcagagtgtattaaccagaatcctgctgcatcttcaaatcactggcagattccagag
ttagcccgaaaagttaatacagagcagaaacataccacttttgagcaacctgtcttttca
gtttcaaaacagtcaccaccaatatcagcatctaaatggtttgacccaaaatctatttgt
aagacaccaagcagcaataccttggatgattacatgagctgttttagaactccagttgta
aagaatgactttccacctgcttgtcagttgtcaacaccttatggccaacctgcctgtttc
cagcagcaacagcagcaaatacttgctactccacttcaaaatttacaggttttagcatcc
tcttcagcaaatgaatgcatttcggttaaaggaagaatttattccatattaaagcagata
ggaagtggaggttcaagcaaggtatttcaggtgttgaatgaaaagaaacagatatatgct
ataaaatatgtgaacttagaagaagcagataaccaaactcttgatagttaccggaacgaa
atagcttatttgaataaactacagcaacacagtgataagatcatccgactttatgattat
gaaatcacggaccagtacatctacatggtaatggagtgtggaaatattgatcttaatagt
tggcttaaaaagaaaaaatccattgatccatgggaacgcaagagttactggaaaaatatg
ttagaggcggttcacacaatccatcaacatggcattgttcacagtgatcttaaaccagct
aactttctgatagttgatggaatgctaaagctaattgattttgggattgcaaaccaaatg
caaccagatacaacaagtattgttaaagattctcaggttggcacagttaattatatgcca
ccagaagcaatcaaagatatgtcttcctccagagagaatgggaaatctaaatcaaagata
agccccaaaagtgatgtttggtccttaggatgtattttgtactatatgacttacgggaaa
acaccatttcagcagataattaatcagatttctaaattgcatgccataattgatcctaat
catgaaattgaatttcccgatattccagagaaagatcttcaagatgtgttaaagtgttgt
ttaaaaagggacccaaaacagaggatatccattcctgagctcctggctcatccatatgtt
caaattcaaactcatccaggtaaccaaatggccaagggaaccactgaagaaatgaaatat
gttctgggccaacttgttggtctgaattctcctaactccattttgaaagctgctaaaact
ttatatgaacactatagtggtggtgaaagtcataattcatcatccaagacttttgaaaaa
aaaagggaaaaaaaatga

DBGET integrated database retrieval system