KEGG   Pongo abelii (Sumatran orangutan): 100441314Help
Entry
100441314         CDS       T01416                                 

Gene name
TTK
Definition
(RefSeq) dual specificity protein kinase TTK isoform X1
  KO
K08866  serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100441314 (TTK)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100441314 (TTK)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: Other
  TTK family
   100441314 (TTK)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100441314 (TTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo APH RIO1 Mad3_BUB1_I_2 Mad3_BUB1_I Tubulin
Motif
Other DBs
NCBI-GeneID: 100441314
NCBI-ProteinID: XP_024104691
Ensembl: ENSPPYG00000016795
Position
6
AA seq 855 aa AA seqDB search
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKNLSASTVLTAQESFSSSLGHLQNRNNSCDSRGQTTKARF
LYGENMPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLSSPDCDVKTDDSVVPCFIKRQ
TSRSECRDLVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELITTDSITLKNKTE
SSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQK
HTTFEQPVFSVSKQSPPISASKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQL
STPYGQPACFQQQQQQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVFQ
VLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMV
MECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLK
LIDFGIANQMQPDTTSIVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLG
CILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRIS
IPELLAHPYVQIQTHPGNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGES
HNSSSKTFEKKREKK
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgaggatttaagtggcagagaattgacaattgattccataatgaacaaagtg
agagacattaaaaataagtttaaaaatgaagaccttactgatgaactaagcttgaataaa
atttctgctgatactacagataactcgggaactgttaaccaaattatgatgatggcaaac
aacccagaggactggttgagtttgttgctcaaactggagaaaaacagtgttccgctaagt
gatgctcttttaaataaattgattggtcgttacagtcaagcaattgaagcgcttccccca
gataaatatggccaaaatgagagttttgctagaattcaagtgagatttgctgaattaaaa
gctattcaagagccagatgatgcacgtgactactttcaaatggccagagcaaactgcaag
aaatttgcttttgttcatatctcttttgcacaatttgaactgtcacaaggtaatgtcaaa
aaaagtaaacaacttcttcaaaaagctgtagaacgtggagcagtaccactagaaatgctg
gaaattgccctacggaatttaaacctccaaaaaaagcagctgctttcagaggaggaaaag
aagaatttatcagcatctacggtattaactgcccaagaatcattttccagttcacttggg
catttacagaataggaacaacagttgtgattccagaggacagactactaaagccaggttt
ttatatggagagaacatgccaccacaagatgcagaaataggttatcggaattcattgaga
caaactaacaaaactaaacagtcatgcccatttggaagagtcccagttaaccttctaagt
agcccagattgtgatgtgaagacagatgattcagttgtaccttgttttataaaaagacaa
acctctagatcagaatgccgagatttggtgcccggatctaaaccaagtggaaatgattcc
tgtgaattgagaaatttaaagtccgttcagaatagccatttcaaggaacctctggtgtca
gatgaaaagagttctgaacttattactactgattcaataaccctgaagaataaaactgaa
tcaagtcttctagctaaattagaagaaactaaagagtatcaagaaccagaggttccagag
agtaaccagaaacagtggcaatctaagagaaagtcagagtgtattaaccagaatcctgct
gcatcttcaaatcactggcagattccagagttagcccgaaaagttaatacagagcagaaa
cataccacttttgagcaacctgtcttttcagtttcaaaacagtcaccaccaatatcagca
tctaaatggtttgacccaaaatctatttgtaagacaccaagcagcaataccttggatgat
tacatgagctgttttagaactccagttgtaaagaatgactttccacctgcttgtcagttg
tcaacaccttatggccaacctgcctgtttccagcagcaacagcagcaaatacttgctact
ccacttcaaaatttacaggttttagcatcctcttcagcaaatgaatgcatttcggttaaa
ggaagaatttattccatattaaagcagataggaagtggaggttcaagcaaggtatttcag
gtgttgaatgaaaagaaacagatatatgctataaaatatgtgaacttagaagaagcagat
aaccaaactcttgatagttaccggaacgaaatagcttatttgaataaactacagcaacac
agtgataagatcatccgactttatgattatgaaatcacggaccagtacatctacatggta
atggagtgtggaaatattgatcttaatagttggcttaaaaagaaaaaatccattgatcca
tgggaacgcaagagttactggaaaaatatgttagaggcggttcacacaatccatcaacat
ggcattgttcacagtgatcttaaaccagctaactttctgatagttgatggaatgctaaag
ctaattgattttgggattgcaaaccaaatgcaaccagatacaacaagtattgttaaagat
tctcaggttggcacagttaattatatgccaccagaagcaatcaaagatatgtcttcctcc
agagagaatgggaaatctaaatcaaagataagccccaaaagtgatgtttggtccttagga
tgtattttgtactatatgacttacgggaaaacaccatttcagcagataattaatcagatt
tctaaattgcatgccataattgatcctaatcatgaaattgaatttcccgatattccagag
aaagatcttcaagatgtgttaaagtgttgtttaaaaagggacccaaaacagaggatatcc
attcctgagctcctggctcatccatatgttcaaattcaaactcatccaggtaaccaaatg
gccaagggaaccactgaagaaatgaaatatgttctgggccaacttgttggtctgaattct
cctaactccattttgaaagctgctaaaactttatatgaacactatagtggtggtgaaagt
cataattcatcatccaagacttttgaaaaaaaaagggaaaaaaaatga

DBGET integrated database retrieval system