KEGG   Pongo abelii (Sumatran orangutan): 100441394Help
Entry
100441394         CDS       T01416                                 

Gene name
SIRT6
Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-6 isoform X1
  KO
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Thermogenesis
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    100441394 (SIRT6)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100441394 (SIRT6)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100441394 (SIRT6)
Chromosome [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     100441394 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
19
AA seq 355 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLHFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLEKALPPLPRPPTPKLEPK
EESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPNWVKAEVVPS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcggggctgtcgccgtacgcggacaagggcaagtgcggcctt
cccgagatcttcgaccccccagaggagctggagcggaaggtgtgggaactggcgaggctg
gtctggcagtcctccaatgtggtgttccacacgggtgccggcatcagcactgcctctggc
atccccgacttcaggggtccccacggagtctggaccatggaggagcgaggtctggccccc
aagttcgacaccacctttgagagcgcgcggcccacgcagacccacatggcgctggtgcag
ctggagcgcgtgggcctcctccacttcctggtcagccagaacgtggacgggctccatgtg
cgctcaggcttccccagggacaaactggcagagcttcacgggaacatgtttgtggaagaa
tgtgccaagtgtaagacgcagtatgtccgggacacagtcgtgggcacgatgggcctgaag
gccacgggccggctctgcaccgtagctaaggcaagggggctgcgggcctgcaggggagag
ctgagggacaccatcctagactgggaggactccctgcccgaccgggacctggcactcgcc
gatgaggccagcaggaacgccgacctgtccatcacgctgggcacatcgctgcagatccga
cccagcgggaacctgccgctggctaccaagcgccggggaggccgcctggtcatcgtcaac
ctgcagcccaccaagcacgaccgccatgctgacctccgcatccatggctacgttgacgag
gtcatgacccggctcatgaagcacctggggctggagatccccgcctgggacggcccccgt
gtgctggagaaggcgctgccacccctgccccgtccgcccacccccaagctggagcccaag
gaggaatcacccacccggatcaacggctctatccccgccggccccaagcaggagccctgc
gcccagcacaacggctcagagcccgccagccccaaacgggagcggcccaccagccctgcc
ccccacagaccccccaactgggtgaaggccgaggtggtcccgagctga

DBGET integrated database retrieval system