KEGG   Pongo abelii (Sumatran orangutan): 100441462Help
Entry
100441462         CDS       T01416                                 

Gene name
LAMC3
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100441462 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100441462 (LAMC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100441462 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100441462 (LAMC3)
   05222 Small cell lung cancer
    100441462 (LAMC3)
  Infectious diseases
   05146 Amoebiasis
    100441462 (LAMC3)
   05145 Toxoplasmosis
    100441462 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 1575 aa AA seqDB search
MAAAALLLGLALLALRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGTQCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADSPWEPYQFYSASCQKTYGRPEGQYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDAAGQLACRCQHNTTGTD
CEHCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTT
GPHCESCQENFYHWDPRMPCQPCDCHSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKEKVEGNLCDRCRPGSFNLQPHNPAGCSSC
FCYGHSKVCAATAQFQVHHILTDFHQGAKGWWARSVGGPEHPPQWSPNGVLLSPEDEEEL
TAPDKFLGDQRFSYGQPLILTFRAPPGNSPLPVQLRLEGAGLALSLRHSSLSGPQDAGHP
REVELRFHLQETSEDVAPPLTPFHFQRLLANLTSLRLRISPGPSPAGQVFLTEVRLTSAR
PGLSPPASWVETCSCPSGYTGQFCESCAPGYKREMPQGGPYASCVPCTCNQHGTCDPNTG
ICVCSHHTEGPSCERCLPGFYGNPFAGQADDCQPCPCPGQSACTTIPESGEVVCTHCPPG
QRGRRCEVCDDGFFGDPLGLSGHPQPCHQCQCSGNVDPNAVGNCDPLSGHCLRCLHNTTG
DHCEHCQEGFYRSTLVPRPADKCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTGRDCSL
CYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGFFSFSIK
GCWACRCSPLGAASAQCHENGTCVCRPGFEGYKCDRCHDNFFLTADGTHCQECPSCYALV
KEEAAKLKARLTLMEGWLQGSNCGSPWGPLDILLGEAPRGDVYQGHHLLPGAQEAFLEQI
MGLEGAVKATREQLQRLSKGARCAQARSQKTCTQLADLEAVLESSEEEILHAAAILSTLE
IPQEGPSQPTKWSHLATEARALARSHRDTATKITATARRALLASNTSYALLWNLLEGRVA
LETQQDLEDRYQEVQAAQKALGTAMAEVLPEAESVLATVQRIGTDTAPYLALLASLGALP
QKSRAEDLGLKAKALEKTVASQQHMATEAARTLQAAAQAALRQTGPLTQLHQEARAALTQ
ASSSVQAATVTVMGARTLLADLEGMKLQFPRPKDQAALQRKADSVSDRLLADTRRKTKQA
ERMLGNAAPLSSSAKKKGREAELLAKDSAKLAKALLREGKQAHRRASRLTSQTQATLQQA
SRQALASEARRQELEEAERVGAGLSEMEQQIRESRISLEKDIEALSELLARLGSLDTHQA
PAQALNETQWALERLRLQLGSPGSLQRKLSLLEQESQQQELQIQGFESDLAEIRADKQNL
EAILHSLPENCASWQ
NT seq 4728 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcgctcctgctggggctggcgctgctggcactgcgggcggccggcgcg
ggcatgggcgcgtgctatgacggcgcggggcgcccgcagcgctgcctgccggtgttcgag
aacgcggcgtttgggcggctcgcccaggcctcgcacacgtgcggcagcccgcccgaggac
ttctgtccccacgtgggcgccgcgggcgcggggactcagtgccagcgctgcgacgccgcc
gacccccagcgccaccacaacgcctcctacctcaccgacttccacagccaggacgagagc
acctggtggcagagcccgtccatggccttcggcgttcagtaccccacctcggtcaacatc
accctccgcctggggaaggcttacgagatcacgtacgtgaggctaaagttccacaccagt
cgccctgagagcttcgccatctacaagcgcagccgcgccgacagcccatgggagccctac
cagttctacagcgcctcctgccagaagacctacggccggcccgagggccagtacctgcgc
cccggcgaggacgagcgcgtggccttctgcacctctgagttcagcgacatctccccgctg
agtgggggcaatgtggccttctccaccctggagggccggcccagcgcctacaacttcgag
gagagccctgggctgcaggagtgggtcaccagcaccgaactcctcatctctctagaccgg
ctcaacacgtttggggacgacatcttcaaggaccccaaggtgctccagtcctactactat
gctgtgtccgacttctctgtgggtggcaggtgcaagtgcaacgggcatgccagcgagtgc
ggccccgacgcggcgggccagttggcctgccggtgccagcacaacaccaccggcacggac
tgtgagcactgcctgcccttctttcaggaccgcccttgggcccggggcaccgctgaggct
gcccacgaatgtctgccctgcaactgcagtggccgctccgaggaatgcacatttgatcgg
gaactcttccgcagcacaggccacggcgggcgctgtcaccactgccgtgaccacacaact
gggccacactgtgagagctgtcaggagaatttctatcactgggacccgcggatgccatgc
cagccctgtgactgccactcggcaggctccctacacctccagtgcgatgacacaggcacc
tgcgcctgcaagcccactgtgactggctggaagtgtgaccgctgtctgcccgggttccac
tcgctcagtgagggaggctgcagaccctgcacctgcaatcccgctggcagcctggacacc
tgtgacccccgcagtgggcgctgcccctgcaaagagaaggtggaaggcaacctatgtgac
agatgtcgacccgggtcctttaacctgcagccgcacaatccggccggctgcagcagctgt
ttctgctatggccactccaaggtgtgcgcggccactgcccagttccaggtgcatcacatc
ctcaccgatttccaccagggagccaaaggctggtgggccagaagtgtggggggccccgag
caccccccacaatggagcccaaatggggtcctcctgagcccagaagatgaggaggagctt
acagcaccagataagttcctgggagaccaacggttcagctacgggcagcccctcatcctg
accttccgggcgccccccgggaactccccactccctgtgcagctgaggctggaaggggca
ggcttggccctgtccctgaggcactctagcctgtctggcccccaggatgctgggcatccc
agggaggtagagctcaggttccacctgcaggagacctccgaggacgtggcccctccactc
acccccttccacttccagcggctgctcgccaacctgaccagcctccgcctccgcatcagt
ccgggccccagccctgccggccaagtgttcctgactgaggtccggctcacatccgcccgg
ccagggctttccccgccagcctcctgggtggagacttgttcatgtcccagtggctacacg
ggccagttctgtgaatcctgtgctccgggatacaagagggagatgccacaggggggtccc
tatgccagctgtgtcccctgcacctgtaaccagcatggcacctgtgaccccaacacaggg
atctgcgtctgcagccaccataccgagggcccatcctgtgaacgctgcttgccaggtttc
tatggcaaccctttcgcgggccaagctgacgactgccagccctgtccctgccctggccag
tcggcctgcacgaccatcccagagagcggggaggtggtgtgcacccactgccccccgggc
cagagagggcggcgctgtgaggtctgtgatgatggtttttttggggacccgctggggctc
tctgggcatccccagccctgccaccagtgccagtgcagcgggaacgtggaccccaatgcc
gtgggcaactgtgaccccctgtctggtcactgcctgcgctgcctgcacaacaccacgggt
gaccactgtgagcactgtcaggaaggcttctacaggagcaccctggtccctcggcccgca
gacaaatgcatgccttgcagctgtcacccacagggctcggtcagtgagcagatgccctgc
gacccagtgacaggccaatgctcctgcctgcctcacgtgactggacgggactgcagcctc
tgctaccctggcttcttcgacctgcagcctgggaggggctgccggagctgcaagtgtcac
ccactgggctcccaggaggaccagtgccatcctaagactggacagtgcacctgccgccca
ggtgtcacaggccaggcctgtgacagatgccagctgggtttcttcagcttctccatcaag
ggctgctgggcctgcaggtgctccccactgggcgctgcctctgcccagtgccacgagaac
ggcacatgcgtgtgcaggcctggcttcgagggctacaaatgtgaccgctgccacgacaac
ttcttcctcacggcagacggcacacactgccaggaatgtccgtcctgctacgccctggtg
aaggaggaggcagccaagctgaaggccagactgactttgatggaggggtggctgcaaggg
tccaactgtggcagtccctggggaccactagacattctgctgggagaggccccaaggggg
gacgtctaccagggccaccacctgcttccaggggctcaggaagccttcctggagcagatc
atgggcctcgagggtgctgtgaaggccacccgggagcagctgcagaggctgagcaagggt
gcccgctgtgcccaggccagatcccagaagacctgcacccagctggcagacctggaggca
gtgctggagtcctctgaagaggagattctgcacgcagctgccattctctcaactctggag
attcctcaggaaggtcccagtcagccgaccaaatggagccacctggccacagaggcccgt
gccctcgccaggagccacagagacaccgccaccaagatcacagccactgctcggagggcc
ctgctcgcctccaataccagctacgcgcttctctggaatctgctggagggaagggtggct
ctagagacccagcaggacctggaggacaggtaccaggaggtccaggcggcccagaaagca
ctggggacggctatggcagaagtgctgcctgaagcggaaagcgtgttggccaccgtgcag
cgaattggcacagatacagccccgtacctggccttgctggcttccctgggagctctgcct
cagaagtcccgggctgaagacctgggcctgaaggcgaaggccctggagaagacagttgca
tcacaacagcacatggccactgaggctgcccgaaccctccaggctgctgcccaggcggcg
ctacggcaaacaggacccctcacacagctgcatcaggaggccagagccgccctgacccag
gcttcctcgtctgtccaggctgccacagtgaccgtcatgggagccaggactctgctggct
gacctggaaggaatgaagctgcagtttccccggcccaaggaccaggcggcattgcagaga
aaggcagactccgtcagcgacagactccttgcagacacgagaaggaagaccaagcaggcg
gagaggatgctgggaaatgcggcccctctttcctccagtgccaagaagaagggcagagaa
gcagagctgttggccaaggacagtgccaagcttgccaaggccttgctgagggaggggaaa
caggcgcaccgccgtgccagccggctcaccagccagacgcaagccacgctccaacaggcg
tcccggcaggcgctggcgtctgaagcacgcagacaggagctggaggaagctgagcgggtg
ggtgctgggctgagcgagatggagcagcagatccgggaatcgcgtatctcactggagaag
gacatcgaggccttgtcagagctgcttgccaggctggggtcgctggacacccatcaagcc
ccagcccaggccctgaacgagactcagtgggcactagaacgcctgaggctgcagctgggc
tctccggggtccttgcagaggaaactcagtctgctggagcaggaatcccagcagcaggag
ctgcagatccagggcttcgagagtgacctcgccgagatccgcgccgacaaacagaacctg
gaggccattctgcacagcctgccggagaactgtgccagctggcagtga

DBGET integrated database retrieval system