KEGG   Pongo abelii (Sumatran orangutan): 100441499Help
Entry
100441499         CDS       T01416                                 

Definition
cytochrome P450 4X1-like
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100441499
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100441499
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP4 family
   100441499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 509 aa AA seqDB search
MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPTPPTHWFLGHQKF
IQDDNMDKLEEIIEKYPRAFPFWIGPFQAFFYIYDPDYAKTLLSRTDPKSQYLQKFSPPL
LGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEV
YEHINLMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKL
SPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTQKRNYQDFLDIVLSAKDESGSS
FSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQ
LGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVW
KNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD
PNRPLTFPSHFILKPKNGMYLHLKKLSEC
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaattctcctggctggagacgcggtgggcgcggcccttttacctggcgttcgtgttc
tgcctggccctggggctgctgcaggccattaagctgtacctgcggaggcagaggctgctg
cgggacctgcgccccttcccaacgccccccacccactggttccttgggcaccagaagttt
attcaggatgataacatggataagcttgaggaaattattgaaaaataccctcgtgccttc
cctttctggattgggcccttccaggcatttttctacatctatgacccagactatgcgaag
acacttctgagcagaacagatcccaagtcccagtacctgcagaaattctcacctccactt
ctcggaaaaggactagcggctctagatggacccaagtggttccagcatcgtcgcctacta
actcctggattccattttaacatcctgaaagcatacatcgaggtgatggctcattctgtg
aaaatgatgctggataagtgggagaagatttgcagcactcaggacacaagcgtggaggtc
tatgagcacatcaacttgatgtctctggatataatcatgaaatgcgctttcagcaaggag
accaactgccagacaaacagcacccatgatccttatgcaaaagccatatttgaactcagc
aaaatcatatttcaccgcttgtacagtttgttgtatcacagtgacataattttcaaactc
agccctcagggctaccgcttccagaagttaagccgagtgttgaatcagtacacagataca
ataatccaggaaagaaagaaatccctccaggctggggtaaagcaggataacactcagaag
aggaactaccaggattttctggatattgtcctttctgccaaggatgaaagtggtagcagc
ttctcagatattgatgtacactctgaagtgagcacgttcttgttggcaggacatgacacc
ttggcagcaagcatctcctggatcctttactgcctggctctgaaccctgagcatcaagag
agatgccgggaggaggtcaggggcatcctgggggatgggtcttctatcacttgggaccag
ctgggtgagatgtcgtacaccacaatgtgcatcaaggagacgtgccgattgattcctgca
gtcccgtccatttccagagatctcagcaagccacttaccttcccagatggatgcacattg
cctgcagggatcaccgtggttcttagtatttggggtcttcaccacaaccctgctgtctgg
aaaaacccaaaggtctttgaccccttgaggttctctcaggagaattctgatcagagacac
ccctatgcctacttaccattctcagctggatcaaggaactgcattgggcaggagtttgcc
atgattgagttaaaggtaaccattgccttgattctgctccacttcagagtgactccagac
cccaacaggcctcttactttccccagccattttatcctcaagcccaagaatgggatgtat
ttgcacctgaagaaactctctgaatgttag

DBGET integrated database retrieval system