KEGG   Pongo abelii (Sumatran orangutan): 100441528Help
Entry
100441528         CDS       T01416                                 

Definition
serine/threonine-protein kinase PAK 2-like
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100441528
   04010 MAPK signaling pathway
    100441528
   04012 ErbB signaling pathway
    100441528
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100441528
  Cellular commiunity
   04510 Focal adhesion
    100441528
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100441528
  Development
   04360 Axon guidance
    100441528
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    100441528
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100441528
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   100441528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 280 aa AA seqDB search
FINLKSGCVFSPSRASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNP
NIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQV
IHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKV
DIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMD
VEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
tttatcaaccttaaatctggttgtgtgttttctccctctagggcttctggtacagttttc
actgctactgacgttgcattgggacaggaggttgctatcaaacaaattaatttacagaaa
cagccaaagaaggaattgatcattaatgagattctggtgatgaaagaattaaaaaatccc
aacatcgttaacttcttggacagttacctggtaggagatgaattgtttgtggtcatggaa
taccttgctggggggtcactcactgatgtggtaacagaaacctgcatggatgaagcacag
attgctgctgtgtgcagagagtgtttacaggcgttggagtttttacatgctaatcaagtg
atccacagagacatcaaaagtgacaatgtacttttgggaatggaaggatcagttaagctc
actgactttggtttctgtgcccagatcacccctgagcagagcaaacgcagtaccatggtc
ggaacgccatactggatggcgccagaggtggttacacggaaagcttatggccctaaagtc
gacatatggtctctgggtatcatggctattgagatggtagaaggagagcctccatacctc
aatgaaaatcccttgagggccttgtacctaatagcaactaatggaaccccagaacttcag
aatccagagaaactttccccaatatttcgagatttcttaaatcgatgtttggaaatggat
gtggaaaaaaggggttcagccaaagaattattacagcatcctttcctgaaactggccaaa
ccgttatctagcttgacaccactgatcatggcagctaaagaagcaatgaagagtaaccgt
taa

DBGET integrated database retrieval system